KEGG   Mus musculus (house mouse): 26568
Entry
26568             CDS       T01002                                 
Symbol
Slc27a3, Acsvl3, FATP-3, FATP3, Vlcs-3
Name
(RefSeq) solute carrier family 27 (fatty acid transporter), member 3
  KO
K08772  solute carrier family 27 (fatty acid transporter), member 3 [EC:6.2.1.-]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    26568 (Slc27a3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    26568 (Slc27a3)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    26568 (Slc27a3)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-
     26568 (Slc27a3)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   26568 (Slc27a3)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   26568 (Slc27a3)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 26568
NCBI-ProteinID: NP_036118
MGI: 1347358
Ensembl: ENSMUSG00000027932
UniProt: O88561 G3X8Y7
Position
3:complement(90292540..90298693)
AA seq 667 aa
MAALLLLLPLLLLLPLLLKLDVWPQLRWLPADLAFTVRALRCKRALRARALAAAAADPES
SESGCSLAWRLAYLAREQPTHTFLIHGAQRFSYAEAERESNRIARAFLRARGWTGGRRGS
GRGSTEEGARVAPPAGDAAARGTTAPPLAPGATVALLLPAGPDFLWIWFGLAKAGLRTAF
VPTALRRGPLLHCLRSCGASALVLATEFLESLEPDLPALRAMGLHLWATGPETNVAGISN
LLSEAADQVDEPVPGYLSAPQNIMDTCLYIFTSGTTGLPKAARISHLKVLQCQGFYHLCG
VHQEDVIYLALPLYHMSGSLLGIVGCLGIGATVVLKPKFSASQFWDDCQKHRVTVFQYIG
ELCRYLVNQPPSKAECDHKVRLAVGSGLRPDTWERFLRRFGPLQILETYGMTEGNVATFN
YTGRQGAVGRASWLYKHIFPFSLIRYDVMTGEPIRNAQGHCMTTSPGEPGLLVAPVSQQS
PFLGYAGAPELAKDKLLKDVFWSGDVFFNTGDLLVCDEQGFLHFHDRTGDTFRWKGENVA
TTEVAEVLETLDFLQEVNIYGVTVPGHEGRAGMAALALRPPQALNLVQLYSHVSENLPPY
ARPRFLRLQESLATTETFKQQKVRMANEGFDPSVLSDPLYVLDQDIGAYLPLTPARYSAL
LSGDLRI
NT seq 2004 nt   +upstreamnt  +downstreamnt
atggcggccctcctgctgctgctgcccttactcttgctcctgcctctgctgctgaagcta
gacgtctggcctcagctgcgctggctgccggccgacctggccttcacagttcgcgccctc
cgctgcaaaagggcccttcgagcacgcgcgctggccgcagcggccgccgaccccgaaagc
tctgagagcgggtgcagtctggcctggcgtctcgcgtacctggcccgggagcagccgaca
cacaccttcctcatccacggcgcgcagcgctttagctacgcggaggctgagcgcgagagc
aaccggattgctcgcgcctttctgcgcgcacggggctggaccgggggccgccgaggctcg
ggcaggggcagcactgaggaaggcgcacgcgtggcgcctccggctggagatgcggctgct
agagggacgaccgcgccccctctggcacccggggcgaccgtggcgctgctcctcccagcg
ggcccggatttcctttggatttggttcggactggccaaagctggcctgcgcacggccttt
gtgcccaccgctttacgccgaggacccctgctgcactgcctccgcagctgcggtgcgagt
gcgctcgtgctggccacagagttcctggagtccctggagccggacctgccggccttgaga
gccatggggctccacctatgggcgacgggccctgaaactaatgtagctggaatcagcaat
ttgctatcggaagcagcagaccaagtggatgagccagtgccggggtacctctctgccccc
cagaacataatggacacctgcctgtacatcttcacctctggcactactggcctgcccaag
gctgctcgaatcagtcatctgaaggttctacagtgccagggattctaccatctgtgtgga
gtccaccaggaggacgtgatctacctcgcactcccactgtaccacatgtctggctccctt
ctgggcattgtgggctgcttgggcattggggccaccgtggtgctgaaacccaagttctca
gctagccagttctgggacgattgccagaaacacagggtgacagtgttccagtacattggg
gagttgtgccgatacctcgtcaaccagcccccgagcaaggcagagtgtgaccataaggtg
cgcttggcagtgggcagtgggttgcgcccagacacctgggagcgtttcctgcggcgattt
ggacctctgcagatactggagacgtatggcatgacagagggcaacgtagctacgttcaat
tacacaggacggcagggtgcagtggggcgagcttcctggctttacaagcacatcttcccc
ttctccttgattcgatacgatgtcatgacaggggagcctattcggaatgcccaggggcac
tgcatgaccacatctccaggtgagccaggcctactggtggccccagtgagccagcagtcc
cccttcctgggctatgctggggctccggagctggccaaggacaagctgctgaaggatgtc
ttctggtctggggacgttttcttcaatactggggacctcttggtctgtgatgagcaaggc
tttcttcacttccacgatcgtactggagacaccttcaggtggaagggagagaatgtggcc
acaactgaagtggctgaggtcttggagaccctggacttccttcaggaggtgaacatctat
ggagtcacggtgccagggcacgaaggcagggcaggcatggcggccttggctctgcggccc
ccgcaggctctgaacctggtgcagctctacagccatgtttctgagaacttgccaccgtat
gcccgacctcggtttctcaggctccaggaatctttggccactactgagaccttcaaacag
cagaaggttaggatggccaatgagggctttgaccccagtgtactgtctgacccactctat
gttctggaccaagatataggggcctacctgcccctcacacctgcccggtacagtgccctc
ctgtctggagaccttcgaatctga

DBGET integrated database retrieval system