KEGG   Mus musculus (mouse): 266632
Entry
266632            CDS       T01002                                 

Gene name
Irak4, 8430405M07Rik, 9330209D03Rik, IRAK-4, NY-REN-64
Definition
(RefSeq) interleukin-1 receptor-associated kinase 4
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    266632 (Irak4)
   04064 NF-kappa B signaling pathway
    266632 (Irak4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    266632 (Irak4)
   04621 NOD-like receptor signaling pathway
    266632 (Irak4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    266632 (Irak4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    266632 (Irak4)
   05135 Yersinia infection
    266632 (Irak4)
   05133 Pertussis
    266632 (Irak4)
   05152 Tuberculosis
    266632 (Irak4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    266632 (Irak4)
   05162 Measles
    266632 (Irak4)
   05164 Influenza A
    266632 (Irak4)
   05161 Hepatitis B
    266632 (Irak4)
   05168 Herpes simplex virus 1 infection
    266632 (Irak4)
   05169 Epstein-Barr virus infection
    266632 (Irak4)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    266632 (Irak4)
   05140 Leishmaniasis
    266632 (Irak4)
   05142 Chagas disease (American trypanosomiasis)
    266632 (Irak4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    266632 (Irak4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     266632 (Irak4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   266632 (Irak4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Death Kdo
Other DBs
NCBI-GeneID: 266632
NCBI-ProteinID: NP_084202
MGI: 2182474
Ensembl: ENSMUSG00000059883
Vega: OTTMUSG00000016696
UniProt: Q8R4K2
Structure
PDB: 
2A9I 1WH4

Position
15; 15 E3
AA seq 459 aa
MNKPLTPSTYIRNLNVGILRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTCELLFDWGTTNCTVGDLVDLLVQIELFAPATLLLPDAVPQTVKSLPPREAATV
AQTHGPCQEKDRTSVMPMPKLEHSCEPPDSSSPDNRSVESSDTRFHSFSFHELKSITNNF
DEQPASAGGNRMGEGGFGVVYKGCVNNTIVAVKKLGAMVEISTEELKQQFDQEIKVMATC
QHENLVELLGFSSDSDNLCLVYAYMPNGSLLDRLSCLDGTPPLSWHTRCKVAQGTANGIR
FLHENHHIHRDIKSANILLDKDFTAKISDFGLARASARLAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLELITGLAAVDENREPQLLLDIKEEIEDEEKTIEDYTDEKMSD
ADPASVEAMYSAASQCLHEKKNRRPDIAKVQQLLQEMSA
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgaacaagccgttgacaccatcgacatacatacgcaaccttaatgtggggatccttagg
aagctgtcggattttattgatcctcaagaagggtggaagaaattagcagtagctatcaaa
aagccgtccggcgacgacagatacaatcagttccatataaggagattcgaagccttactt
cagaccgggaagagccccacctgtgaactgctgtttgactggggcaccacgaactgcaca
gttggcgaccttgtggatctactggtccagattgagctgtttgcccccgccactctcctg
ctgccggatgccgttccccaaaccgtcaaaagcctgcctcctagagaagcggcaacagtg
gcacaaacacacgggccttgtcaggaaaaggacaggacatccgtaatgcctatgccgaag
ctagaacacagctgcgagccaccggactcctcaagcccagacaacagaagtgtagagtcc
agcgacactcggttccacagcttctcgttccatgaactgaagagcatcacaaacaacttc
gacgagcaacccgcgtctgccggtggcaaccggatgggagaggggggatttggagtggtg
tacaagggctgtgtgaacaacaccatcgtggcggtgaagaagctcggagcgatggttgaa
atcagtactgaagaactaaagcaacagtttgatcaagaaattaaagtaatggcaacgtgt
cagcacgagaacctggtggagctgctcggcttctccagcgacagcgacaacctgtgctta
gtgtatgcttacatgcccaacgggtccttgctggacagactgtcctgcctggatggtaca
ccaccgctttcctggcacacaaggtgcaaggttgctcaggggacagcaaatggcatcagg
tttctgcatgaaaatcatcacattcatagagatattaaaagtgcaaatatcttactagac
aaagactttactgccaaaatatctgactttgggcttgcacgggcttcggcaaggctagcg
cagacggtcatgaccagccgaatcgtgggcacaacggcttacatggcacccgaagctttg
cggggagaaataacacccaaatctgacatctacagcttcggcgtggttctgttggagctg
ataaccgggctggcggctgtggatgaaaaccgtgaacctcaactactgctggatattaaa
gaagagattgaagatgaagagaagacgattgaagattacacggatgagaagatgagcgat
gcggaccctgcttcggtggaagcaatgtactctgctgctagccagtgtctgcatgagaag
aaaaacagacggccagacattgcaaaggttcaacagctgctacaagagatgtctgcttaa

DBGET integrated database retrieval system