KEGG   Mus musculus (mouse): 266645
Entry
266645            CDS       T01002                                 

Gene name
Acmsd
Definition
(RefSeq) amino carboxymuconate semialdehyde decarboxylase
  KO
K03392  aminocarboxymuconate-semialdehyde decarboxylase [EC:4.1.1.45]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00380  Tryptophan metabolism
mmu01100  Metabolic pathways
Module
mmu_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    266645 (Acmsd)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.45  aminocarboxymuconate-semialdehyde decarboxylase
     266645 (Acmsd)
SSDB
Motif
Pfam: Amidohydro_2 SPW
Other DBs
NCBI-GeneID: 266645
NCBI-ProteinID: NP_001028213
MGI: 2386323
Ensembl: ENSMUSG00000026348
Vega: OTTMUSG00000049346
UniProt: Q8R519
Position
1; 1 E3
AA seq 336 aa
MKIDIHTHILPKEWPDLEKRFGYGGWVQLQQQGKGEAKMIKDGKLFRVIQQNCWDPEVRI
REMNQKGVTVQALSTVPVMFSYWAKPKDTLELCQFLNNDLAATVARYPRRFVGLGTLPMQ
APELAVEEMERCVKALGFPGIQIGSHINTWDLNDPELFPIYAAAERLNCSLFVHPWDMQM
DGRMAKYWLPWLVGMPSETTMAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTIGRIAHGF
NMRPDLCAQDNPSDPRKYLGSFYTDSLVHDPLSLKLLTDVIGKDKVMLGTDYPFPLGEQE
PGKLIESMAEFDEETKDKLTAGNALAFLGLERKLFE
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgaaaattgacatccacactcatattctaccaaaggaatggcccgatctagaaaagagg
tttggctatggaggctgggtgcagctccaacagcaaggcaagggagaagcaaagatgata
aaagatgggaagctcttcagagtgatccaacagaactgctgggacccagaagttcgtatc
agagaaatgaaccagaaaggagtgacagtccaagctctttccacagttcctgtcatgttt
agctactgggccaaacctaaggatactttggagctgtgccagtttttaaacaatgaccta
gctgccaccgttgccagataccctcgaaggtttgtgggtttggggacgttgcctatgcaa
gccccggagctggccgtcgaggagatggagcgttgtgttaaggcgctaggatttccagga
atccagattggctcccacatcaacacatgggacctgaatgacccggaactcttcccaatc
tatgctgcggccgagaggctgaactgttctctgttcgtgcatccctgggatatgcagatg
gatggacgaatggccaaatactggctgccttggctcgtaggaatgccatcggagaccacc
atggccatttgctccatgatcatgggtggggtgtttgagaagtttcccaaactcaaagtg
tgcttcgcacacggaggtggtgctttccccttcaccataggaagaattgcccatggattc
aacatgcgcccagatctctgtgcccaggacaatccgtctgaccccagaaaataccttggc
tccttctacacagactccctggttcacgatcctctgtctctcaagctattgacagatgtc
ataggaaaggataaagtcatgctgggaactgattacccctttcctctgggcgagcaggag
cctgggaagctgatagagtccatggcagagtttgatgaagaaacaaaggataaacttaca
gctggcaatgccttggcttttttgggtcttgagagaaaactatttgaatga

DBGET integrated database retrieval system