KEGG   Mus musculus (house mouse): 26754
Entry
26754             CDS       T01002                                 
Symbol
Cops5, AI303502, CSN5, Jab1, Mov34, Sgn5
Name
(RefSeq) COP9 signalosome subunit 5
  KO
K09613  COP9 signalosome complex subunit 5 [EC:3.4.-.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    26754 (Cops5)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    26754 (Cops5)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-
    3.4.-.-
     26754 (Cops5)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M67
   26754 (Cops5)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   COP9 signalosome (CSN) complex
    26754 (Cops5)
SSDB
Motif
Pfam: JAB CSN5_C Prok-JAB UPF0172
Other DBs
NCBI-GeneID: 26754
NCBI-ProteinID: NP_038743
MGI: 1349415
Ensembl: ENSMUSG00000025917
UniProt: O35864
Position
1:complement(10094825..10108384)
AA seq 334 aa
MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISAL
ALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAY
IENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGK
VNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLEL
LWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL
AKATRDSCKTTIEAIHGLMSQVIKDKLFNQINVA
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggcagcttccgggagtggtatggcccagaaaacctgggaattggccaacaacatgcag
gaagcgcagagtatcgatgaaatctacaaatatgacaaaaaacaacaacaagaaatcctg
gcggcgaaaccctggactaaggatcaccactactttaaatactgcaaaatctcagcattg
gctctactgaaaatggtgatgcatgccaggtcaggaggcaacttggaagtgatgggtttg
atgctcgggaaagtcgacggcgagaccatgatcatcatggacagtttcgctttgcctgta
gagggcacagaaactcgagtaaatgctcaagctgctgcgtatgagtatatggctgcatac
atagaaaatgccaaacaggttggccgccttgagaatgcaatcggttggtatcatagccac
cctggttatggctgctggctctccgggattgatgttagtacacagatgctgaaccagcag
tttcaagaaccatttgtagcagtggtgattgatccaaccagaacaatctctgcaggaaaa
gtgaatcttggcgcctttaggacatatccaaagggctacaaacctcctgatgaaggacct
tctgagtaccagactatcccacttaataaaatagaagattttggcgtgcactgcaaacaa
tattatgccttagaagtctcatatttcaaatcatctttggatcgtaaactacttgagctt
ttgtggaataaatactgggtgaataccctgagttcctctagcttgcttactaatgcagac
tacaccacaggccaggtgtttgatttgtctgagaagttagagcagtcggaagcccaactg
ggacgtggcagtttcatgttgggcttagaaacacatgaccgcaagtcggaagacaaactt
gccaaagctactagagacagctgtaaaaccaccatagaagccatccatggactgatgtct
caggttattaaggataaactgtttaatcagattaacgttgcttag

DBGET integrated database retrieval system