KEGG   Mus musculus (house mouse): 268294
Entry
268294            CDS       T01002                                 
Symbol
Zbtb24, Bif1, Bsg1, ZNF450
Name
(RefSeq) zinc finger and BTB domain containing 24
  KO
K10503  zinc finger and BTB domain-containing protein 24
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    268294 (Zbtb24)
   04121 Ubiquitin system [BR:mmu04121]
    268294 (Zbtb24)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    268294 (Zbtb24)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     268294 (Zbtb24)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 BTB zf-C2H2_4 zf-C2H2_jaz zf-met zf-Di19 zf-C2H2_6 Zn-ribbon_8 zf_UBZ DUF2180 zf-C2HE DUF6011 AT_hook zinc_ribbon_15 zf-C2HC_2 HypA
Other DBs
NCBI-GeneID: 268294
NCBI-ProteinID: NP_700447
MGI: 3039618
Ensembl: ENSMUSG00000019826
UniProt: Q80X44
Structure
Position
10:41326354..41341578
AA seq 710 aa
MADTTPEPCGQLMVHSDTHSDTVLASLEDQRKKGFLCDITLIVENVHFRAHKALLAASSE
YFSMMFAEEGEIGQSIYMLEGMVADTFGILLEFIYTGYLHASEKTTEQILATAQFLKVYD
LVKAYADFQDNHSAPKPPALNCTGTPVVVISNKKNDPLKRKRGRPRKANGLQEGRSELAA
EGELQLRVNNSVQNRQNFVFKEEDSVKLSEQTPEDKESEPAGEPGSVEEVPAEKDENFDP
KAGDGQESQSRCSRRRIRRSVKLKDYKLLGDEDDQSTAKRLCGRKKRSSGPEARCKDCDR
VFKYSHFLAIHQRRHTGERPFKCNECGKGFAQKHSLQVHTRMHTGERPYTCTVCGKALTT
KHSLLEHMSLHSGQKSFTCDQCGKYFSQKRQLKSHYRVHTGHSLPECSHCHRKFMDVSQL
KKHLRTHTGEKPFTCEICGKSFTAKSSLQTHIRIHRGEKPYSCSICGKCFSDSSAKRRHC
ILHTGKKPFSCPECGLQFARLDNLKAHLKIHSKEKHTADSSSVSGSNVDEGRNILQLQPY
QLSTSGEQEIQLLVTDSVHNINFMPGPSQGVSIVAAESPQSMATDPAANITLLTQQPEQL
QGLILSAQQEQAEHIQSLSVIGGQMESSQTEPVHVITLSKETLEHLHAHQEQTTSSVPAA
DTGARATPVPSTRPGAELTQAPLAVPLDPSPGATVAGWPFGPSSYRSLKM
NT seq 2133 nt   +upstreamnt  +downstreamnt
atggcagacacaaccccggagccttgtgggcagcttatggtacactcagacactcacagt
gacactgtgctggccagtctggaggatcaaaggaagaagggctttctttgtgatattact
ttaatcgtggagaatgtgcatttccgagcccataaagccttgctggccgccagtagcgag
tatttctcaatgatgtttgcggaagagggcgagattggccagtctatctacatgctggaa
ggcatggttgcagacacctttggcatcctgctggaatttatctatacaggttatctacat
gccagtgagaaaacgacagagcagatcctggctactgctcagttcttaaaagtctatgac
ctggtaaaggcatacgcagacttccaggataaccatagcgccccaaagccaccagctttg
aactgcactgggacgccagtggtggttatttccaataagaagaacgatcctctgaaacgg
aaacggggaagaccaagaaaagccaatggtttgcaggaagggagatcagaactggctgca
gagggagagctgcagctgagagtgaacaattcagttcagaatagacaaaactttgtgttt
aaagaagaagacagtgtcaagctgagtgagcagactccagaagacaaggaatcagagcct
gctggtgagccaggaagcgtggaggaggtgcctgctgaaaaggacgagaactttgacccc
aaggctggggatggacaggagagccagagtaggtgcagcaggcggagaatccgcaggtct
gtcaagctcaaagactacaagcttcttggagatgaagatgaccagagtactgccaagagg
ctatgtggaagaaaaaagcgctccagcggtcccgaggcccggtgtaaagactgcgacaga
gtctttaaatatagtcacttcttagcaatccaccagagacgccacacgggggaacgaccc
ttcaaatgtaatgagtgtgggaagggctttgctcagaagcactccttgcaggtccatacc
aggatgcacacgggggagcggccatacacctgcaccgtgtgcggcaaggcgctgaccacc
aagcactccctgctggagcacatgagcctgcactcaggacagaagtcttttacctgtgat
cagtgtggaaaatatttcagccagaaaagacagctaaagagccattatcgtgtccataca
ggccactcactaccagaatgcagccactgccaccgaaagtttatggacgtgtcccagctg
aagaagcacctgcggacacacacaggcgagaagccatttacttgtgaaatctgtgggaaa
tctttcacagcaaagagctcccttcagacccacatcaggatccaccgaggagaaaagcca
tactcctgcagcatctgtggcaaatgcttctctgactccagtgccaagaggagacactgc
atcctgcatacgggcaagaagcccttctcctgccccgagtgtggcttacagttcgctcgc
ctagacaatttgaaggcacacttgaaaatccacagcaaagagaagcacacggcagactcc
agcagtgtttctggcagtaatgtggacgagggcaggaacattcttcagctgcaaccatac
cagctctccacgtcgggagagcaggagattcagcttcttgtcaccgactctgtgcataac
attaacttcatgccaggtcccagccagggggtcagcatcgtggctgccgagagcccccag
agcatggccacagacccggctgccaacatcaccctgctcacacagcagcctgagcagctg
cagggcctgatcctttccgctcagcaggagcaggcagagcacattcagagcctcagtgtg
attggaggccagatggagtcctcccagactgagccagtgcatgtcatcacactttccaag
gaaacgctggagcatctccacgcccaccaggagcaaacaaccagctcagtacctgcagct
gacacaggagcccgagccacccctgtcccctccactaggccaggagcagagctgacccaa
gcgcctctggccgttccactagacccttcccctggagcaacagtggcagggtggcctttt
gggccatcatcttacagatccttaaagatgtga

DBGET integrated database retrieval system