KEGG   Mus musculus (mouse): 268379Help
Entry
268379            CDS       T01002                                 

Gene name
Abca13, 9830132L24, A930002G16Rik, AI956815
Definition
(RefSeq) ATP-binding cassette, sub-family A (ABC1), member 13
  KO
K05647  ATP binding cassette, subfamily A (ABC1), member 13
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    268379 (Abca13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    268379 (Abca13)
Transporters [BR:mmu02000]
 ABC Transporters, Eukaryotic Type
  ABCA (ABC1) subfamily
   ABCA1, 2, 3, 4, 7, 12, 13 subgroups
    268379 (Abca13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_tran ABC2_membrane_3 AAA_21 AAA_29 AAA_23 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 268379
NCBI-ProteinID: NP_839990
MGI: 2388707
Ensembl: ENSMUSG00000004668
Vega: OTTMUSG00000005151
UniProt: Q5SSE9
Position
11; 11 A1
AA seq 5034 aa AA seqDB search
MGHAGRQFQALLWKNWICRLRHPVLSLAEFFWPCILFMILTVLRFQEPPRHRENCYLQAR
DLPSRGVLPFVQGLLCNTGSSCRNISFESSMDHHFRLSRFQTASDDRKVSSLAFLNEIQD
LAEDIFETMDKAKNLQKLWLKRSETPGSSYGSGFLTMDLNKTEDVISKLESLHQQPHIWD
FLHSLPRLYMSSAHLEDSMGAVTHFLQAGLNSLASLGDLDWLPLHQTIPQVSRHVLNVTI
STLRFLQQHSAVVNETIYHLSLKNIVWDPQKVQSDLKSQFGFNDFQMQHILNYSAKLEEI
PTHSFLERMVCSILSNTSEDEAESKGYRADCHPKWSAVKNYIIHAVSWLKLYGQVFDQWQ
QGSLLQSLLAGASHSLAALREQFKQQSESWKVVEALHTALLILNDSLAADVPRDYHLFPQ
IFQHLSKLQHALSDLSPWPALKRLLLLDTVLRNMIAQDLRFVQEFLSYLERSAKDFIPAG
SEGWRLEKDVLFQGLNQLLTKNASALCLNGHLSQEAALPTGNSSIWRSVWGVLCHTLFFN
ETSVLNELLRAVKDAGHSLQAVIAGHTNGSVSEHGGHFGWQDLGTQLSEISLTCSRVFQL
PRADTSPENSFSPGGCESQLVSIVVSHILEDVQMSTQKKSYWKILSKIVRKTCELARYVN
MNGSLQNSGLISFSEDSPCYTQDMNWKVIIDNYFVFFNNFKKSPITSITTAFNFTKHLLV
VDQKLHTLENGQMNILLSFVEFVEKLLSNPSGSFPAPEFDNLSSLTELVFNATVSWLTHL
KRLKADSHDAAPQELLEFDHLVTEKIQRLKNHWMKKGSKNILNFLELILLEMNSELQEFR
LNGIPQEERTNIEGFSTLVNFSVAEYEKILCKRFTFSQLFHSYWPKSPAINADFIHLSET
IIQSLCGLSFLTQEQVSIALNTVSALQNTSELFSALSEPQKQELDNFLTHVYINVFKDKN
IALFLQTYSSFYRYIHKFFNIQNREPLIAYFTQISRHILDLIKQFNIQNIREALSFLSET
TEALGMISEVSHCQQLLSIFNFLELQAWSLMARGGPAEAVIHASLTGLKQLFAADEGFRV
SLLQYVTQCFNGSAATLVASECFIQENATISSVNYSGNEGSSLPFPWTQFFSNLSVNGSA
ISEFTAIHCTLSWIQTWAEIWRSIAQIFKLELSIFTPLHVGITQLLDDLGNYGNISKDCQ
GIVPTYLTARLILNLFRNITQENNFHDWDGLQDLRDLWVAFGNELTTVQSLNLDQVEKTF
ITMETSLHQLKTFPMKINASREFLYSLFDVFIELSKASDYVDRNVELINNFLSDDLPDHQ
AKFASIIKELKETILFLRHVSQGRTLSACADIFQRLTELIFEDSLLLVNTSNKPEHILAM
LSSMFSSKNTSSSLEGCITWIDIINHLCIMYNSSSLPSHSYNILGSFKDMGDKMSSALNI
LTWMLNKKRPICPWNESNINCVNIYLKDITDFLNIIVTTGLEKENVPNVEILLSLFNDST
KQVDMIITNLTEDLNVASQSNWKHFKDLLLRPTEMSDDIPDQFQNIWQHIIALGKEMQKL
LKGIFHSVLGNNFSSNTETMFSVFSTSPKEGDISHLGKSIYNLANYFALNLTHNLQNSSE
VFPHEILKAVDLSIQLTRDVFNFLMPAVHFNIPQNSDHAQTLKKVTSLMQSLKKADIELL
VGQLGENSEILMSFFKNLSRSGIDNLGVNMLVGLVEKFVDSSHSWSVSHLLRLSRLLPKD
VVDTVLDVYYALPHIVGLLRRIVDKNITESLRDVYNFTLLHGITMFKITKEDFADVVKTL
LDAVELVSDEPAIVPEALMCLTRVWCANYTTFRLEKNPKVEDCNIQRHMPSSFFHMVTSL
LDLLHLPPPSDSQCIGEKYAVEITRRLACAVHDLADWNSILSELLEIFHVKNLLVKTLQG
FWHKVLLFMSSSGIQGNGSIPELCPTSTIKQGALQIIEKLKYVNFTKFSLGETILDRLGN
LDRILSLTKGTEKSVQNNIYLNLERLFKLISATWTLRNSTHYLLSPITNFLNGNYTGWSL
FKNNRTSSNIEELWLDFKQIPKDLTSNWSLGQLLSDINKNIQGAGLQNTTVQLPQLLELL
DSSPLKTSEIIEGFLFLIKPWLREYENGDFFRFIQSLLNAVASGNSTDVSRLARDFTMYL
GYLRNQSREGNFDVGFFSHMLDQEHLTDLPVVQRLLESIVMNSVSSFAALSQETPPSFSG
TNLQIADLMNLILKHAQSKNHAEAEGSTEDFLKQLPETFFSSVINGLHSDVTAEVSFVPR
DKILEILKLDPFLTWMNKNPLMNIFSGLKTLYYLIKSSFSLDNRELSGVLKDLSHTHPWE
TTVKTDAEGHLDFFSVVTQFLSQVNSSEDLSKFNQNLRSVLYLVQESSTEMATIIDTVLH
STSGACYSPYPMLQHSTVAKLSDLFSDVNSSFPLRSREILESTMRLFGTISQVGEESHVL
ESALEIFRTLTMLVNSTVELGHLASTADSMVRLLNLAKIVSRKMATMLGTLSISSTEDSG
KFLDTLYSFMLQSVPHHVKQITTLKKGDPFIVEKTKDLLIPFLDLAFGMIGVTPNVSQDS
DVFSMPFSILSYINQSRDFSETLEGMAENLISIKISLRDWEHFVAMIKNRTQNFSIDAAD
LWEEILGCLVPISNITTQMDFLKLYELSSTSHPQVPKQERTHDVIRYLDGMLTDNGTERE
TFLKMVIDLTLQALWNGLKEDNWDIFNLLLAFAQHPNDLLKAIESVVAVSSGIHSDYPDD
FNQDSFSDLSLIQNTTRYQLAKAVLIGLGKAGFSREGLPLNNTQWTHFTRTLFHPDYNSF
PNSTPHQNVTSAKDGRTKDEMMVILHGSEPMPYLQRFLKALFVSIEHWQEVPQAEQSVFE
MCQVFQQLQKPMKTVKMLQRVEMMALRVLIIFAENPSLTKDILCAALSCKQGAMRHLILA
ALQGVTLVHRHYQEIGKIWFSPDQLDCERLSRNLSSALEGFKSILDNASSHRCTCQPLVG
VVQQHIRRLTKSLEEVWMSKIPAMTFLSNFTVTEDVKIKDLMRNITKFTEDLRSFFHISE
ETIHSILEANISHSKVLSSVLTIALSGKCDEEILHLLLTFPESEKSWFVTRELCSLPGSQ
VFSLLVMMGQNLNLRNLIYKTLIPSEANGLLKSLLDVVASLSSILARAQHALEYLPEFLH
TFKITALLDMPDFQQVSSKGQTRSSAFASFQSVMKLLCKDQESFLSNSNMFINLPRVNEL
LEDNKEKFNIPHDSTPFCLKLYQEILQSPNGALVWSFLKPVLHGKILYTPNSPEINEVIQ
KANYTFYFVDKIKVLSETFLKISKLFQGSGNGQMFNQLQDALRNKFIRNFVESQLHIDMD
KLTEDLQTYGRMLDKMFNHVEAGHFRFLGGMLANLSSCVVLDRFQAVETVDTLETKAHEL
MQQNSFLASIIFNSSLRHRHIRSAPHKLPPHVTYTIRTNVLYSMRTDMIKNPSWKFHPQN
LPAGGFKYNYIFVPLQDMIERAIIVVQTGQESLEPTTQAQAAPYPCHTSDLFLNNVGFFF
PLIMMLTWMVAVASMVRKLVYEREIQIEEYMRMMGLHPTIHFLSWFLENMATLALSSAAL
AVILKMSGIFMHSDAFIIFLYLLDFGVSAVMMSYFLSVFFNQANTAALCTSLGYMISFLP
YVVLLVLHNQLSFAIQTLLCLLSTTAFGQGVFFITFLEGQEEGIQWGNMYRAPEPGGMTF
GWVCWMILFDAILYFLGGWYFSNLVPGTFGLGKPWYFPFTASYWKSICGLMERRRCSLSS
GLFFFNEDFGNKGLSQQNGPGEMEGGNPGVALISVTKEYEDHKVAVQELTLTFHRDQITA
LLGTNGAGKTTIISMLMGLFPPTSGTITINGKNLQTDLSKVREELGVCPQQDVLLDNLTV
REHLMLFASIKAPWWTTKELQQQVNKTLDEVELTQHQHKPAGVLSGGMKRKLSIGIAFMG
MSKTVVLDEPSSGVDPCSRRSLWDILLKYREGRTIIFTTHHLDEAEMLSDHVAVLQQGRL
RCYAPPADLKETYGQGLTLTLSKQPSILETQEPKDVARVTSLIQIYIPQAFLKDSCGGEL
TYTIPKDADRTCFKGLCQALDQNLQHLHLTGYGISDTTLEEVFLMLLQDTNKKSYITPDN
KVEPQNERPVGPLSPHNVSPLSTPPEGALPEPIGGCQLLLGQAVALLRKRLLHTLRAWKS
TTSDLLLPVLFVALAMGLFMVQPLAITYPPLKLTPGHYETAETYFFSSGNHGPDLTHVLL
RKFRDQDPVCADAFRMNSSSWHRDPYSGPESQDSCGCLKCPNKSAGAPSLTNCLGHTLLN
LSGYDVEEYLLVPSAKPRLGGWSFGGQIPNDAEDVKTNTSKPRTLAKVWYNQKGFHSLPS
YLNHLNNLILWHHLPANAVDWRQYGITLYSHPYGGALLNEDRILESIRQCGVALCIVLGF
SILSASIGSSVVRDRVTGAKRLQHISGLGHRTYWLINFLYDMLFYLVSVCLCVAVIGAFQ
LTAFTFRENLAATALLLALFGYAMIPWMYLMSRIFSSSDVAFISYISLNFIFGLCTMLMT
TMPRLLAIISKAQNLQKIYNVLKWAFTIFPQFCLGQGLIELCYNQIKYDLTHNFGIDSYV
SPFEMNFLGWIFVELTLQGTFLLLLRLMLHGDLLRWPRDHSVLQDIVKPAKDIDVETEQM
RVLEGRTGGDMMVLCNLSKSYRSVFGGKTTAVHGISLGIPRGECFGLLGVNGAGKSTTFK
ILNGETPPSSGYTVIRTPQGDMVDLASAGKAGILIGYCPQQDALDELLTGWEHLQYYCRL
RGIPKQYIPEVAADLVRRLHLESHVDKPVATYSGGTRRKLSTALALVGKPDILLLDEPSS
GMDPCSKRYLWQTITQEVRDGCAAVLTSHSMEECEALCTRLAIMVDGSFRCLGPPQHIKN
RFGDGYTVKVWLHKEGSQPSAVSDCLKLHFPGIQFKGQRLNLLEYHVQKSWECLADLFKV
LENNKSLLNIEHYSISQTTLEQVFVNFATEQLQTPCFPVDSPSTDAQHPCYTRI
NT seq 15105 nt NT seq  +upstreamnt  +downstreamnt
atggggcacgctgggcgccagttccaagccctgctctggaagaactggatttgcagactc
cggcatccagtcctctccctggctgagttcttctggccgtgtatcctgttcatgattctg
acagtacttcgttttcaagaacctcccagacacagagagaattgttacttgcaagcccgg
gatctgcccagccggggtgttcttccttttgttcaaggacttctttgtaatactggctca
agttgtagaaacatcagctttgagagttccatggatcatcattttcgtttgtctaggttc
caaactgcatctgatgacagaaaagtcagtagcttggcctttttaaacgagattcaggat
ctggctgaggacatttttgaaaccatggacaaggcaaagaacttacaaaaactctggcta
aaaagatcagaaaccccaggttcctcttatggctccggttttctaacaatggatctcaat
aagactgaggatgtgatatcaaaattggaaagccttcaccagcagcctcatatttgggat
tttctacattcactgcccagactgtacatgtccagtgctcacttggaagatagcatgggt
gctgtgacacactttctccaggcgggtttgaattcattagcatctctgggagatttggat
tggctacccctgcaccagaccatcccccaggtttctagacatgttctgaacgtgaccatc
tccaccctgaggtttctgcagcagcacagcgctgttgtcaatgagaccatttaccacctg
tccctgaagaatatcgtctgggatccccagaaagtccagtctgatctcaaatcccaattt
ggtttcaatgactttcaaatgcaacacatcctgaattattcagcgaagctggaggagatt
cctacacacagcttcctagagaggatggtatgttccatcttgtccaacacttctgaggat
gaagccgagagcaagggctaccgggcagactgtcatcccaagtggtcagcagtcaagaac
tacatcatccatgcagtcagttggctgaagctatacggacaggtgtttgaccagtggcag
cagggtagtctgctgcagagcctgcttgcaggtgccagtcacagtctggcagcccttagg
gagcagtttaaacagcagagcgagtcgtggaaggtggtggaagccctgcacactgccctg
ctcatcttgaatgacagcttggcagcggatgtccccagagactaccatctgtttccacag
atattccagcatctaagcaagttgcagcatgccctgtcagacctgtccccatggccagct
ctgaagagattgctcctgctggatactgttctccggaacatgattgcccaggatttgcga
tttgttcaagaattcctcagctacctggagaggtcagcaaaagattttatacctgctggg
tctgaaggatggagactagaaaaggatgtgttatttcaggggctaaaccagctgttgaca
aagaatgcttctgccctttgcctgaatggacatttgtctcaggaggctgccctccccact
gggaactctagcatatggaggagtgtctggggagtgctatgccataccctattcttcaac
gagaccagtgttttaaatgagctgcttcgagcagtgaaggatgctggtcatagtttgcaa
gctgtcattgcaggacacacaaatggatcagtttcagaacatggtgggcattttggctgg
caggatcttgggacacagctgtcagaaataagccttacctgttctcgggtcttccagctt
ccaagagctgatacctcacctgagaatagtttctctcctggtggctgtgaaagccagctt
gtctccatagtggtatctcacatacttgaagatgtacaaatgtctacgcaaaagaagtcc
tactggaaaatcctctcaaaaatcgtcaggaagacatgtgaattggctcgatatgtgaac
atgaatggcagtcttcagaacagtgggctgatatctttctctgaggactctccttgttat
acacaagacatgaattggaaagtcatcattgataattattttgtatttttcaataacttt
aagaagtctccaataacttccataaccacggccttcaatttcacaaagcaccttttagtg
gtggatcagaagttgcacacccttgaaaatggacagatgaacattcttctgtcgtttgtg
gagtttgtggagaaattactatctaatccctctggctcattccctgctcctgaatttgat
aatctgtcttctctcactgagcttgttttcaatgcaactgtttcatggctaactcattta
aagcgtttaaaggcagactcccatgatgctgctcctcaggagcttctggaatttgatcat
ctggtcactgaaaaaattcaaagacttaaaaatcattggatgaagaagggatctaaaaat
attttgaactttttagaattaatacttcttgaaatgaattcagaactgcaagaattccgg
ctcaatggcattccacaagaagaaagaactaacattgaaggcttttccacacttgtaaat
ttttctgttgcagaatatgaaaaaattctttgtaaacgctttactttctcccaattgttc
cattcctattggcccaaatcaccagccattaatgcagactttatacatttaagtgagact
ataatacagagtctctgtggacttagctttctgacacaggagcaagtctcaatagctctg
aacactgtctctgctctgcagaatacatctgagcttttctctgccctttctgagccacaa
aaacaagaactggataactttttgactcatgtatacataaatgtcttcaaggacaaaaac
atagctctatttttgcaaacctattcctcattctatcgatatattcataaattcttcaac
attcagaatagagagcctctgatagcttattttactcaaatctccagacacattttggac
ctcataaagcagtttaatatccaaaacatcagagaagcactttcgtttttatcggagaca
acagaggctcttgggatgatatctgaagtatctcactgtcagcagttactttcaattttc
aactttttagaacttcaagcctggtccctgatggcaagagggggaccagcagaagcagtg
attcatgctagtttgacaggcctcaagcagctgttcgcagcagatgaaggctttcgtgtt
tctttacttcagtatgtgactcagtgttttaatggttcagcagcaactctagtggcgagt
gaatgcttcattcaggaaaatgctaccatttcttctgtgaattattcaggaaacgagggg
tcttcccttccttttccatggacacaatttttttccaacctctcagtaaatggtagtgca
atcagcgaattcacggccattcactgcaccctttcatggattcagacgtgggctgagatc
tggagaagcattgctcaaatatttaagcttgagctgagtatttttactcctcttcatgtt
ggtatcactcagctgttggatgacctgggaaattatgggaacatttctaaagactgccaa
ggaatagttcccacataccttactgctaggctcatattaaatttgtttagaaatataact
caggagaataacttccatgactgggatggccttcaggacctcagggatctttgggtagca
tttggtaatgaattaactacagtacaatcacttaacctggaccaagtagagaaaactttt
atcaccatggaaacctccctgcaccagctgaagacatttccaatgaaaataaatgcaagc
agggagtttttatattccctgtttgatgttttcattgagttaagtaaagcctcagactat
gtggatagaaatgtggagttgatcaataactttctttcagatgatcttcctgatcatcaa
gccaaatttgcaagcatcatcaaggagctgaaagaaacaatattatttcttaggcatgtg
tcacagggtagaactttatcagcatgtgctgatattttccagagactcactgagttgatt
tttgaagatagcttattacttgtgaacacttctaataagccagaacatattctggccatg
ttaagttctatgttttcatcaaagaacacaagtagcagcctggaagggtgcatcacatgg
atagatatcataaaccatctgtgtataatgtataactcaagttccttacccagtcatagt
tataacatactgggaagctttaaggatatgggggacaaaatgagctctgcattgaacatt
ttaacttggatgctaaataagaaaagacccatttgtccatggaatgagtcaaatataaat
tgtgtaaatatttacttgaaagacataactgactttctaaatattatagttactacaggc
ttggaaaaagagaatgtgcccaatgttgagattttattatctcttttcaatgattccaca
aagcaggtagacatgatcattaccaacttaacagaagatctcaatgttgcttcccagtcc
aactggaagcacttcaaggatttacttctaagacccacagaaatgtcagatgatattcct
gaccagtttcagaatatttggcagcacatcatagcattggggaaggaaatgcagaagctt
ttaaaaggtattttccatagtgtcctcggaaataatttctcttctaacactgaaacaatg
tttagtgtattctctaccagtccaaaggaaggagatataagccatttaggcaaatcaatt
tacaacttagctaactactttgctcttaacctaactcataatcttcagaattcatcagaa
gtattcccacatgaaatattgaaagctgtagatcttagtatacaattgacacgggatgtg
ttcaattttttaatgcctgctgtccacttcaatattccacaaaattcagatcatgctcaa
actttaaagaaagtgacatctctcatgcaatctctcaagaaggcagacatagagctttta
gtaggtcagctgggagaaaacagtgaaatcctaatgagtttctttaagaatctcagcaga
tcaggtattgacaacttgggggtcaatatgcttgtgggcttagtggaaaaatttgtagac
agttcacattcatggagtgttagccacctgttgcgtctctcccgtctgcttcccaaggat
gtggtggatactgtgttggatgtatattatgctcttccccacattgtgggactccttcgg
agaatcgtagataaaaacatcacagaaagcctcagggatgtctataactttacccttctt
catggcataaccatgttcaaaatcaccaaggaagactttgctgatgtcgttaagactctt
ctggatgcagttgagttggtatcagatgagccagctattgttccagaagctttgatgtgc
cttaccagggtttggtgcgcaaactacacaactttcaggcttgagaaaaaccctaaggtc
gaagactgtaatatccagaggcacatgccttcatccttctttcacatggtgaccagtcta
ctggatcttcttcacctgccacccccaagcgactcacagtgcataggtgaaaagtatgca
gtggaaataaccaggagattggcctgtgcagtccatgacctagcagactggaattccatt
ctctcggagctattggagattttccatgttaaaaatttacttgtgaaaactctgcaggga
ttttggcataaggtactgctcttcatgtcatcttctggaattcaaggtaatggcagcatc
ccagaactctgtcctactagtaccataaagcaaggtgctttgcaaatcatagaaaagcta
aaatatgtcaattttacaaaattctcactgggtgaaaccattctggacaggctaggtaac
ttagacaggattcttagcctcactaaaggtacagagaaatctgtccaaaataatatttac
ttaaatttggaaaggttattcaaattgatttctgctacttggactttaagaaatagtact
cattatctactctctccaatcacaaactttctgaatggaaattatacaggttggagtttg
tttaaaaacaatagaacaagttccaacattgaagaactgtggttggactttaaacagatt
cccaaagatctaactagtaactggagcctaggacagttactttccgatattaacaaaaat
atccaaggtgcaggtcttcaaaacaccactgtgcaacttcctcaacttctggaactcctg
gattcatcaccattgaagacatcagaaattattgaaggttttctatttctcataaaaccc
tggcttcgtgagtatgaaaatggagacttctttaggtttattcaaagtctactcaatgcc
gtggccagtgggaattcaactgatgtaagtaggttggccagggattttactatgtatttg
ggttatctcagaaaccaatctagagaaggcaattttgatgttggctttttcagccatatg
ctagatcaagagcacctcactgatctcccagttgttcagcggcttcttgaaagcattgtg
atgaattcagttagtagctttgcagcgctatctcaggaaacgcctcccagtttcagcggc
accaaccttcaaatagcagatctcatgaatctcatcttgaagcacgcgcagtccaaaaac
catgcggaagctgaaggaagcacagaggatttcctgaagcagcttccagagacattcttc
tcctccgtgataaatggattgcatagcgatgtcactgcagaggtgagttttgtccctaga
gataaaatccttgaaattctgaaactggatccgttccttacctggatgaacaaaaaccca
ttgatgaacattttctcaggtctcaagacactatattatctgattaagagctcattttca
ttagacaacagagaactctctggagtcctgaaggatttatctcacacccatccatgggag
accacagtgaaaactgatgccgaaggccatttggatttcttttcagtagtgactcagttt
ctctcccaggttaatagttctgaggacctctccaaattcaaccaaaatctcaggtctgtt
ctctaccttgtacaggaaagttctacagaaatggctactattattgacactgtcttacat
tcaacttctggggcctgctactccccctatcctatgcttcagcatagcacagttgctaag
ctaagtgacttgttttctgatgtcaacagttcattccctctaagaagcagagaaatacta
gaatcaactatgaggctatttggcactatttcccaggttggtgaagaaagtcatgtcctg
gagtcagccttagaaatatttagaactctgactatgctggtgaatagcactgttgaacta
ggccatcttgcctcaactgcggactccatggttagacttctcaacctagccaaaattgtt
tcaagaaagatggctacaatgttgggaacgctctccatctctagtactgaggactctggg
aaattccttgacactttgtattccttcatgctacaaagtgttccacatcatgtgaagcaa
ataactactttgaaaaaaggagatccttttatagttgaaaagacaaaggatttattgata
ccatttcttgacttggcctttggaatgattggagtcacacctaatgtatcacaggactct
gatgttttcagcatgccatttagcatactttcatatatcaaccaatccagagacttttct
gagactttggaaggaatggctgaaaacttaatttctataaaaatcagcttgagagattgg
gagcattttgtggcaatgattaaaaataggactcaaaatttctctattgatgctgctgac
ttatgggaagaaattttaggttgtttagtccctataagtaacatcacaacccagatggac
ttcttgaagctttatgagctctcttctaccagccatcctcaggtcccgaaacaggagaga
actcatgatgtaatccggtatttggatggaatgttaacagataacggcacagaaagagag
actttcttgaaaatggtgattgacctcaccttacaagctctttggaatggcttaaaggaa
gataactgggatatttttaatctcctgttggcatttgcccagcatccaaatgatctttta
aaagccatagaatcagttgtagcggtctctagtggaatccacagtgactatccagatgat
ttcaaccaagattcattttctgatttgtcactgattcagaacactactcgttatcagctt
gcaaaggctgtcctgattggtctcggcaaagcaggcttctcaagggaagggctgcccctg
aacaacactcagtggacacatttcacacgcactctgtttcacccagattacaacagtttt
cctaattcaacccctcatcagaatgtcacatcagcaaaggatgggaggaccaaggatgaa
atgatggtaattcttcatggctcagagccaatgccatacctccagagattcctgaaggca
ttatttgtatcgattgagcactggcaggaagtcccacaagctgagcaaagtgtttttgag
atgtgtcaagttttccagcagctgcagaagcccatgaaaactgtgaagatgctgcagaga
gtggaaatgatggctctgcgggtgctcattatctttgcagaaaatccttccctgactaag
gacattctgtgtgctgcgctgagttgcaagcaaggtgcgatgaggcaccttatcttagct
gctttgcaaggagtcactttggtccatcgccactaccaggagattggaaagatatggttc
tcacctgatcagttggactgtgaacgtcttagcaggaatctttccagtgccttggaaggc
tttaaaagcatcttggacaatgcttccagccatcgctgcacgtgccagcccttggtggga
gtggttcagcagcacatacgcaggctgaccaaaagtcttgaggaggtttggatgtcaaag
attcctgctatgacatttcttagcaatttcacagtcacagaggatgtaaaaataaaggat
ttgatgaggaacatcaccaaattcactgaggaccttcgctccttcttccacatctctgag
gaaaccatccacagcatcttagaagccaacatttcccattcaaaggttctctccagtgtc
cttaccatcgctttgtctggaaaatgtgatgaagaaattctccatctcctgctgacgttt
cctgagagtgaaaaatcctggtttgtcacaagggaactctgcagcctgcctgggtctcaa
gtcttctctctacttgtgatgatgggccagaacctgaacctgaggaacctcatttacaaa
actctgataccctctgaagcaaatggcttgctgaagtctctgttggatgtcgttgctagc
ctcagctccattcttgccagagcccagcatgcccttgaatacctccctgagtttcttcac
acatttaaaatcactgccttgctggacatgccagacttccaacaggtttcatcaaaggga
caaaccagaagttcagctttcgcctctttccagtctgtaatgaagcttctctgtaaggac
caggagtctttcctcagcaattctaacatgttcattaatttacccagagttaatgaactc
ttggaagataacaaagagaagttcaacattccgcatgactcaacaccattctgtttgaag
ctttatcaggaaattctacagtctccaaatggtgcactagtatggtcttttctaaaacct
gtattacatggaaaaatattgtatacaccaaactctccagagattaatgaggtcattcaa
aaggctaattatacattttactttgtggataagataaaagttttatcggaaacatttctg
aagatatccaaacttttccagggaagtggaaatggtcaaatgttcaaccagttgcaggat
gccctgagaaacaaatttataagaaactttgtagagagccagttgcatattgacatggac
aagctcactgaagatctgcagacatatggacggatgttagataagatgtttaaccacgtg
gaagctggacacttccggttcttgggtggtatgttggccaatctctcttcctgtgtggtg
ttggaccgattccaggcagtggagactgttgacaccctggagaccaaggcacatgaactc
atgcagcagaatagtttcttggccagtattatattcaacagttccttgagacatagacac
attagatcagcacctcacaaattgccaccccacgtcacatatacaatccggaccaatgtc
ttatacagcatgaggacagacatgataaaaaatccttcctggaagtttcatcctcagaat
ctaccagccggcggattcaaatataactacatttttgtcccacttcaagacatgattgag
agagccatcattgtggtacagactgggcaggaatccctggagccaaccacacaggcacag
gcagcaccctacccatgccataccagtgacttgttcctaaacaatgtcggcttctttttc
ccactgattatgatgttgacttggatggtagctgtggccagcatggtccggaagctggtg
tatgagcgagagatccagatagaagagtacatgcggatgatgggactgcatccaaccatc
cacttcctgtcctggttcctggagaacatggccactctggctctgagcagtgctgctctt
gctgtcattctgaagatgagtggcatcttcatgcacagtgatgccttcatcatttttctt
tacttgctggattttggggtgtcagctgtcatgatgagctacttcctaagtgtgtttttc
aaccaagctaatacagcagccctgtgtaccagcctggggtacatgatcagtttcctgccc
tatgtggtcctgttggtcctacataaccaactcagtttcgctattcagactcttctgtgc
ttgctttcaaccacagcctttggacaaggagtctttttcatcacatttctggaaggacag
gaggaagggatccagtggggtaacatgtaccgcgctccagagccagggggcatgacattt
ggctgggtgtgctggatgattctgtttgatgcaatcctttattttttgggtggatggtac
ttcagcaacttggtccctggaacttttggtttagggaaaccatggtatttccccttcact
gcatcatattggaagagcatatgtggtctgatggagagaaggcgatgttctctgagttct
ggtctgttcttcttcaatgaggactttggcaacaaagggctctcacagcaaaatggccca
ggagaaatggaaggaggtaacccaggagtggctctgatatctgtgaccaaggagtatgaa
gatcacaaggtggctgtccaggaactcactctcaccttccacagagaccagatcacagcc
ctgctggggaccaacggtgcagggaaaaccaccatcatatccatgttgatggggctcttt
cctcctacttctggaaccatcaccataaatggcaagaatctgcagacagatttgtccaag
gtcagagaggagctgggggtgtgtccacagcaggatgttctcctggacaacctcactgtg
cgtgaacacctaatgctctttgcctccataaaagcaccttggtggaccacgaaggagcta
cagcagcaagtcaacaaaactcttgatgaagtagagctaactcagcatcagcacaagcca
gctggagttctctctggaggcatgaagaggaagctctccattggcattgctttcatgggc
atgtcaaagacagtggttctggatgagccaagcagtggggtggacccttgttcccgtcgc
agtctctgggacattctactcaagtaccgagaaggtcgcacaattatcttcacaacccac
cacctggatgaagctgagatgctcagtgaccacgtggctgttctccagcaggggaggctc
agatgctatgctcctcctgcagacctgaaggagacctatggtcaaggactcaccctgacg
ctcagcaagcaaccctctatcctagaaacacaggagcccaaggatgtggctcgtgttaca
tccttgatacagatctatattccacaagcattcctcaaagatagctgtggaggtgagctg
acctataccatccccaaggatgcagacagaacctgcttcaaggggctctgccaggctctg
gatcagaacttacagcacctgcacctaacaggatatgggatctcagacaccaccttggaa
gaggtgtttttgatgcttctgcaagataccaacaaaaagtcttacatcactccagacaac
aaagtagagcctcagaatgagagacctgtaggacccctttctccccacaatgtctctccc
ctgagcactccaccagaaggggccctgcctgagccgataggtggctgccagctacttctg
ggacaagcagtggcactcctgaggaagcggctactgcatacacttcgagcctggaaaagc
accacctcagatttgttactgcctgtgctctttgtggccttggccatgggcttgttcatg
gtgcagcctttggccatcacgtaccctccactcaaacttacacctggccattacgagact
gcagaaacttacttcttcagcagtgggaaccatggcccagacctaactcatgtgcttctg
cgcaagttccgagatcaagaccctgtctgtgctgatgctttcaggatgaattcttcaagc
tggcatagggacccttattctggcccagaatcccaggactcatgtggctgcctgaagtgt
ccaaataaaagcgctggtgctccctctctgaccaactgcctgggacacacactgctcaac
ctctcgggctatgatgtggaagagtacttgctggtgccatctgcaaaaccaaggcttgga
ggttggtcttttggaggacaaatacccaatgatgctgaagatgtgaagacaaacacatca
aaaccaaggactttggcgaaggtgtggtacaaccagaagggtttccattctctaccctcc
tacctgaatcatctcaacaacctgatcttgtggcatcacttacctgccaatgctgtagac
tggagacaatatggaataaccctgtacagccacccatatggaggggccttgctgaatgaa
gacaggatcctggagagcatccgccagtgtggtgttgccctctgcattgtcctgggattc
tccatcttatcagcatcgattggtagctctgtggtgagggacagagtgactggagctaaa
agactgcaacatataagtggccttggacacaggacatactggctaattaacttcctgtat
gacatgctcttttacttagtttctgtctgcctgtgtgtcgctgttataggagccttccag
ttaacagctttcacatttcgggagaacttggcggccacagccctcctgctagcacttttc
ggatacgcaatgattccatggatgtatctgatgtccagaatcttctccagttcagatgtg
gccttcatctcctacatctccttgaacttcatctttggcttgtgcaccatgttgatgacc
accatgccccggctcttggccatcatttccaaagctcagaatttgcagaaaatctacaat
gtcctcaagtgggcttttactatttttcctcaattctgcctgggtcaagggcttatagaa
ctctgttataatcagatcaagtatgatctgactcacaactttggcattgattcttatgtg
agtcccttcgagatgaattttttgggctggatcttcgtggagttgaccttgcagggcaca
tttcttctcctcttgaggctgatgttacatggagaccttctgagatggccaagggaccac
tctgtcctgcaggacatagttaagcctgctaaggacatagatgttgaaacagagcaaatg
agggtgcttgaaggaagaactggaggagacatgatggtgttgtgcaacctcagtaaaagt
tacagaagtgttttcggggggaagaccacggcggtgcatggcattagtctgggcatacca
cgaggcgagtgctttgggctccttggagttaatggtgctgggaagagcacaacatttaaa
attctgaacggcgaaactcccccaagttcaggatacaccgtcatcaggactcctcaagga
gatatggtggatctggcttctgctggcaaagcaggcattctgattggctactgtccacag
caggacgccctggatgagcttctgactggctgggaacatcttcaatactactgtagactc
cgtggaattccaaagcagtacatcccagaggttgctgcagacctggtgcgacgcttgcac
cttgagtctcatgtggacaaacctgtagccacttacagtgggggcaccagacggaagctc
tccacagccctggccctggtgggaaagcctgatattcttttattggatgaaccaagctct
gggatggacccctgctctaagcggtacctctggcaaacaataacacaagaggttcgggat
ggctgtgccgcagtgctaacctctcacagcatggaagagtgcgaggctctgtgtactcgg
ctggccataatggtggatggcagctttaggtgtcttgggcccccccagcacatcaagaac
aggtttggtgatggttacacagtcaaagtttggctccacaaggaaggaagtcagcctagt
gcagtttctgactgcttgaagctccatttcccaggaatccagtttaagggacagcgcctt
aatttattggaatatcatgtacaaaagagttgggagtgtttagctgatttgttcaaagtt
cttgagaacaacaagagcctcctgaatattgagcattactccatcagccagaccactctg
gaacaggtctttgttaattttgccactgagcagctgcaaactccatgctttcctgttgat
tcaccatctactgatgctcagcatccatgctacacacgcatctag

DBGET integrated database retrieval system