KEGG   Mus musculus (mouse): 268395
Entry
268395            CDS       T01002                                 

Gene name
Mpg, 9830006D05, AI326268, APNG, Aag, Mid1
Definition
(RefSeq) N-methylpurine-DNA glycosylase
  KO
K03652  DNA-3-methyladenine glycosylase [EC:3.2.2.21]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    268395 (Mpg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    268395 (Mpg)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     268395 (Mpg)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     268395 (Mpg)
 Prokaryotic type
     268395 (Mpg)
SSDB
Motif
Pfam: Pur_DNA_glyco
Other DBs
NCBI-GeneID: 268395
NCBI-ProteinID: NP_034952
MGI: 97073
Ensembl: ENSMUSG00000020287
Vega: OTTMUSG00000005371
UniProt: Q04841
Position
11 A4; 11 18.83 cM
AA seq 333 aa
MPARGGSARPGRGALKPVSVTLLPDTEQPPFLGRARRPGNARAGSLVTGYHEVGQMPAPL
SRKIGQKKQRLADSEQQQTPKERLLSTPGLRRSIYFSSPEDHSGRLGPEFFDQPAVTLAR
AFLGQVLVRRLADGTELRGRIVETEAYLGPEDEAAHSRGGRQTPRNRGMFMKPGTLYVYL
IYGMYFCLNVSSQGAGACVLLRALEPLEGLETMRQLRNSLRKSTVGRSLKDRELCSGPSK
LCQALAIDKSFDQRDLAQDDAVWLEHGPLESSSPAVVVAAARIGIGHAGEWTQKPLRFYV
QGSPWVSVVDRVAEQMDQPQQTACSEGLLIVQK
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgcccgcgcgcggtggtagtgcgcgcccgggcagaggagccctaaaaccggtgtccgtg
accctgctccccgacaccgagcagcctccatttcttggacgagcccgccgcccagggaat
gccagagcaggatccctagtgaccggatatcatgaggtcggccagatgccagcgccgctt
tcccgaaagattgggcaaaaaaagcagcgactggcagattcagagcagcagcagacccct
aaagagagactcctgtcgaccccgggcctccggcggagtatctacttctccagcccagag
gaccattctggccggctaggaccagagttttttgaccagccagcagtcaccctagcccgt
gcatttctgggacaggttcttgtccggcgactcgctgatggaacagaactccgtgggcgc
attgtggagactgaggcatacttggggccagaagatgaagctgctcactcaagaggtggc
cggcagaccccccggaaccgtggcatgttcatgaaacctgggaccctgtatgtgtacctc
atctatggcatgtacttctgcttgaatgtctctagtcaaggggctggggcttgtgtcttg
ctaagagcactagagcccctggagggcctggagaccatgcggcagcttcgtaactccctc
cgaaaaagcactgtcggccgttccctcaaggaccgtgaactctgtagtggtccctccaag
ctgtgccaggccctggccattgataagagctttgaccagcgagacctggctcaagatgat
gctgtgtggctggagcatggccctctggagtccagtagcccagctgtggtggtggcagca
gcccgtataggtattggtcatgcaggggagtggacacagaagcccttgcgcttctatgtc
cagggcagcccatgggtcagtgtggtagacagagtggctgaacagatggatcagcctcag
caaacagcctgctctgaggggcttttaattgttcaaaagtaa

DBGET integrated database retrieval system