KEGG   Mus musculus (mouse): 268451Help
Entry
268451            CDS       T01002                                 

Gene name
Rab11fip4, A730072L08Rik, RAB11-FIP4, mKIAA1821
Definition
(RefSeq) RAB11 family interacting protein 4 (class II)
  KO
K12485  Rab11 family-interacting protein 3/4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    268451 (Rab11fip4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    268451 (Rab11fip4)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    268451 (Rab11fip4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RBD-FIP EF-hand_7 Shugoshin_N EF-hand_8 bZIP_1 bZIP_2 EF-hand_9 VGPC1_C Leu_zip
Motif
Other DBs
NCBI-GeneID: 268451
NCBI-ProteinID: NP_780752
MGI: 2442920
Ensembl: ENSMUSG00000017639
Vega: OTTMUSG00000000184
UniProt: Q8BQP8
Position
11 B5; 11 46.88 cM
AA seq 635 aa AA seqDB search
MAGGAGWAGAPAALLRSVRRLREVFEVCGRDPDGFLRVERVAALGLRFGQGEEVEKLVKC
LDPNDLGRINFKDFCRGVFAMKGCEELLKDVLSVESAGTLPCSPDIPDCVEQGSDFSGST
DGEQLPREPDFFQEDEEEAMTLALPEGPQELDMDSPMESSQGPEGSVKGCGEEKEPELGG
LFLPEDKCLVLTPSVTTSDLSTHSTASLISNEEQFEDYGEGDDVDCAPSSPCPDDETRTN
VYSDLGSSVSSSAGQTPRKMRHAYNSELLDVYCSQCCKKINLLNDLEARLKNLKANSPNR
KISSTAFGRQLMHNSNFSSSNGSTEDLFRDSIDSCDNDITEKVSFLEKKVTELENDSLTS
GGLKSKLKQENMQLVHRVHELEEMVKDQETTAEQALEEEARRHREVYCKLEREKSTELEL
LNTRVQQLEEENTDLRTTVARLKSQTEKLDEERQRMSDRLEDTSLRLKDEMDLYKRMMDK
LRQNRLEFQKEREATQELIEDLRRELEHLQMYKLDCERPGRGRSSSGLGEFNARAREVEL
EHEVKRLKQENHKLRDQNDDLNGQILSLSLYEAKNLFATQTKAQSLAAEIDTASRDELME
ALKEQEEINFRLRQYMDKIILAILDHNPSILEIKH
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtggcgcgggctgggcgggcgcccccgcggctctgctgcgctccgtgcgccgc
ctgcgcgaagtgttcgaggtgtgcggccgcgaccccgacggctttctacgcgtggagcgc
gtcgcggcgctcggcctgcgcttcgggcaaggagaggaggtggaaaaacttgtgaagtgt
ttggatcccaatgacctggggagaatcaacttcaaggatttttgccgcggagtattcgcc
atgaaagggtgtgaggagctgctgaaggacgtgctgtcggtggagagcgcagggaccctg
ccatgttctccagacatcccagactgtgtggagcagggcagcgacttctctggctctact
gatggcgagcaactccccagggaacccgacttcttccaggaagacgaagaggaagcgatg
acattggccctacctgagggaccccaggagttagacatggacagtcccatggagagcagc
caaggcccggagggctctgtcaagggttgtggcgaggagaaggagcctgagctggggggc
ctgttcctgccagaggacaagtgcctcgtcctcactccatctgtgaccacatcagacctt
tccactcactccaccgcctctcttatcagcaacgaggagcaatttgaagactatggcgag
ggggatgacgtggactgtgctcccagcagcccatgccccgacgatgagaccagaaccaat
gtctactcagatctgggatcttcagtgtcttccagtgcgggacagaccccaaggaagatg
cgacatgcctacaacagcgagctgctggacgtgtactgctctcagtgctgcaagaagatc
aacctgctgaatgacctggaggcccggctgaagaacctgaaggccaacagccccaaccgg
aagatctcaagcacagcctttggacggcagctcatgcacaacagtaacttcagcagcagt
aatggcagcaccgaggacctgttccgtgacagcatcgactcctgtgacaatgacatcaca
gagaaggtgagcttcctggaaaaaaaggtaacagaactggagaacgacagcctgacgagc
gggggcctgaagagcaagctgaagcaagagaacatgcagctggtgcacagggtgcacgag
ctggaggagatggtgaaggatcaggagaccacagcggagcaggcgctggaggaggaggcc
cggcgacaccgtgaggtctactgcaagctggagcgggaaaagagcacagagctggagctg
ctcaacaccagggtgcagcagttggaggaagagaacacagatctgagaacgacagtggct
cgactcaagtcacagaccgagaagctggacgaggagcggcagcgcatgtctgaccggctg
gaggacaccagcctgcgactgaaggacgagatggacctttacaagcgcatgatggacaag
ctgcggcagaaccgcctggagttccagaaggagcgggaggcgacgcaggagctcatcgag
gacttgcggagagagctggagcacctgcagatgtacaagctggactgcgagcggccaggt
aggggccgcagctcctctggccttggcgagttcaacgccagagcccgggaggtggaactt
gaacatgaggtcaagcgtctgaagcaggagaatcacaagctgcgggatcagaatgatgat
ttaaatgggcagatcctgagcctcagcctctacgaggcgaagaacctctttgcaacccag
accaaagcccagtctctggctgcagaaatcgacacagcatctcgagatgagctaatggag
gccctgaaggagcaggaggagatcaacttccgactgagacagtacatggacaagattatc
ctggctatactggaccacaacccctccatcttggagattaaacactga

DBGET integrated database retrieval system