KEGG   Mus musculus (mouse): 268465
Entry
268465            CDS       T01002                                 

Gene name
Eme1, 6820428D13
Definition
(RefSeq) essential meiotic structure-specific endonuclease 1
  KO
K10882  crossover junction endonuclease EME1 [EC:3.1.22.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03440  Homologous recombination
mmu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    268465 (Eme1)
   03460 Fanconi anemia pathway
    268465 (Eme1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    268465 (Eme1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.-  
     268465 (Eme1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     268465 (Eme1)
SSDB
Motif
Pfam: ERCC4
Other DBs
NCBI-GeneID: 268465
NCBI-ProteinID: NP_808420
MGI: 3576783
Ensembl: ENSMUSG00000039055
Vega: OTTMUSG00000002020
UniProt: Q8BJW7
Position
11; 11 D
AA seq 570 aa
MALRRLSLSRLSTESDSEDLPTFAFLKKEPSSTNRKPPQRAKNIVVVTSDSEASCPPSPG
LKGPPCVPSAAGAPPQAGPVRVLSSSSEDEDVFVPLAERITCKLLTSKQLCPELSSSSLK
TGLDGQNNASAPCDWKRQPWPKIPDVPLHGALEKSAANDEDSLLDDQCRQLPTYQATCRE
LAVSKTNSDRPLPKKRTKHIQTVQSGGSQGCWRPGQASRKENTPRQHERKKKAEMIKRLK
AQRPEECLKHIVVVLDPVLLQMEGGGQLLGALQAMECSCVIEVQAIPRSITWRRRRTELV
EDGDDWMEEPTILVLVLAEVFMSMAYNLKQASPSSTEKGKETLRSFVTDVTAKTGKALSL
VIVDQEKCFRPQNPPRRRKSGMANKQAKAKHQQRQESSTGLMVSRADMEKALVDLQLYTE
AQAWMVQSWKELADFTCAFTKAVAEAPFKKLRDQVTFSFFLEKDWAGGMKVDQSGRGLAL
IWRRQIQQLNRVSSEMASAIVDAYPSPQLLVQAYQRCFSEQERQNLLADIQVRRGEGVTA
TSRRVGPELSRRIYLQMTTAQPDLILDSVD
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggctctaagaaggttatccctgtctcgcctctccacggagagtgattctgaggacctg
cccacatttgcctttttgaagaaggaaccatcttcaaccaacaggaagccacctcagagg
gcgaagaacatagtggttgtcacctcagattctgaagcctcctgtcctccatcaccaggc
ctcaaaggtccaccatgtgtccccagtgcagctggagctcccccacaagcagggccagtc
agagtgctaagcagtagcagtgaggacgaagatgtatttgtccccctagctgagaggatc
acatgtaagcttttgacgagcaagcagctgtgccctgagctctctagctcctcacttaaa
acaggtttggatggccaaaataatgccagcgcaccatgtgactggaaaaggcaaccatgg
ccaaagattcccgatgttcccctccacggtgccttagagaagagtgctgcaaatgatgag
gactctctcttagacgatcagtgtcgtcagcttccaacctaccaggctacctgcagggag
ctggcagtctccaaaacaaattccgaccgacctctacccaagaagagaaccaagcatatt
cagacggtccagagcggaggctctcagggatgctggcgaccgggacaggcaagcaggaag
gaaaacaccccgaggcagcatgaaagaaaaaagaaggcagagatgatcaagaggctcaaa
gcccagaggccagaggaatgcctgaagcacatcgtggtggtgctggatccagtgctttta
cagatggaaggtgggggccagctcctgggagcgctgcaggccatggagtgcagctgtgtg
attgaagtccaggccatacctcgaagcatcacttggaggaggaggaggacagagctggta
gaggatggagatgactggatggaagagccaacaatcctggtgttggtcctggcagaggtc
ttcatgtccatggcctacaacttaaagcaggcaagtcctagcagcaccgagaaagggaag
gagacccttcggagctttgtaactgatgtcacagcaaagacggggaaagcattgtcactg
gtgattgtggaccaggagaaatgcttcaggcctcagaatcccccgaggagaaggaaatca
ggaatggcaaataaacaggccaaagcgaagcatcagcagaggcaagagtctagcacggga
ctcatggtgtccagggcagacatggagaaggcactggtggatctgcagctttatacagaa
gcccaggcgtggatggtgcagagctggaaggagctggcggacttcacctgtgcatttaca
aaggctgtggctgaagcacccttcaagaagctccgggatcaagtcaccttttccttcttc
ctggagaaagactgggctggagggatgaaagtggaccagtccggcaggggactggcactg
atctggaggcggcagatccagcagctgaaccgagtcagctcggagatggccagtgctatt
gtggacgcctatccctcaccacagctcctggtgcaggcttatcagcggtgtttctctgag
caagaacgtcagaatttgctggctgacatacaagtgcgacgtggggaaggtgtgacagcc
acctcccgccgtgttgggccagaattatccaggcggatctaccttcaaatgaccacagcg
caaccagatctcatcttagacagtgttgactga

DBGET integrated database retrieval system