KEGG   Mus musculus (mouse): 268482
Entry
268482            CDS       T01002                                 

Symbol
Krt12, AI835216, K12, Krt-12, Krt1-12
Name
(RefSeq) keratin 12
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    268482 (Krt12)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    268482 (Krt12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    268482 (Krt12)
   04147 Exosome [BR:mmu04147]
    268482 (Krt12)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     268482 (Krt12)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   268482 (Krt12)
  Exosomal proteins of other body fluids (saliva and urine)
   268482 (Krt12)
  Exosomal proteins of colorectal cancer cells
   268482 (Krt12)
  Exosomal proteins of melanoma cells
   268482 (Krt12)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 APC_N_CC DUF4407
Other DBs
NCBI-GeneID: 268482
NCBI-ProteinID: NP_034791
MGI: 96687
Ensembl: ENSMUSG00000020912
Vega: OTTMUSG00000004989
UniProt: Z4YJD9
Position
11:complement(99306490..99313419)
AA seq 487 aa
MSLSVCTSALSRRSSSQNGAAGRPWGASASSVAGGYGGSASGFGVGCGGLFSAASMFGSS
SGFSGGSAGCLPGLGSAYGGPLRGGAGGMGIGMGIAGSSGGGSLCIFSGNDGGLLSGSEK
ETMQNLNDRLASYLGKVRSLEEANAELENKIREWYETRRTRDAGSQSDYSKYYPLIEDLK
NKIVSARVSNAQLLLQIDNARLAAEDFRMKYENELALRQTVEADINGLRRVLDELTLTRA
DLEAQLETLTEELAYMKKNHEEELQSFQAGGPGEVNVEMDAAPGVDLTKVLNEMRAQYEA
MAEQNRKDAEAWFLEKSRELRKEISSNTEQLQSSKSEVTDLKRMVQNLEIELQSQLAMKS
SLEGSLAETEGGYCCQLSQVQQLIGSLEEQLQQVRADAERQNADHQRLLGVKARLEMEIE
TYRRLLEGDSQGDGFDESSSLSVSKPQTPSVDSSKDPNKTRKIKTVVQEIVNGEVVSSQV
QELEEEM
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgtcgctttcagtctgcacctctgcgctgtccaggaggtcttcctcacagaatggggcg
gcaggcagaccttggggtgcatctgcttctagtgttgccggcggctatgggggatcggcc
tctggctttggagttggctgtggaggcctcttttctgctgcttccatgtttggttctagt
tctggctttagcggtggctctgcaggttgcttgccggggcttggctctgcctatggggga
cctctgagaggtggcgcgggaggaatggggatagggatggggatagctggaagctcgggc
ggtggctctctgtgtatcttttctggcaatgatggaggtcttctttctggttctgagaaa
gaaaccatgcaaaatctaaatgacagactagcttcctacctgggtaaggttcgctctcta
gaggaggctaatgcagaactggaaaacaaaattcgagagtggtatgaaacacggagaacc
agagacgctgggtctcagagtgattacagtaaatactacccactgattgaagacttgaag
aataagatcgtttctgccagagtcagcaacgcccagctcctcctgcagattgacaacgca
aggctggctgccgaggacttcaggatgaagtatgagaatgagctggccctgcgccagacc
gtggaggccgacatcaacgggctgcgaagggtgctggacgagctgaccctgactagagcc
gacctggaagcccagcttgagaccctcactgaggagctggcttacatgaagaagaaccac
gaagaggaactccaaagtttccaggcaggtggtccaggtgaggtcaatgtagaaatggac
gcggcccctggagtggatctcaccaaggtcctcaatgaaatgagagcccagtatgaagcc
atggctgagcaaaatcggaaagatgcagaggcctggtttcttgaaaagagcagagagctc
cgaaaagagatcagcagcaacacggagcagcttcagtccagcaagagcgaggtcaccgac
ctgaagcgcatggtgcagaacctagagattgaactccagtcccagctcgccatgaagtcg
tccctggaaggctcgctggctgaaaccgagggtgggtactgctgccaactgtctcaggtg
cagcagctgatcggcagcctggaggagcaactccaacaggtgcgggctgacgcggagcgc
cagaatgcggaccaccagcggctgctgggcgtcaaggctcgcctggagatggagattgag
acctaccgccggctgctggagggggacagccaaggcgacggttttgacgagagctcatcc
ctttctgtctccaaaccgcagacaccatcagtcgattcctctaaagacccaaataaaact
cgaaaaatcaagacagtcgtgcaggagatagtgaatggcgaagtggtctcatcccaggtt
caggaacttgaagaagagatgtaa

DBGET integrated database retrieval system