KEGG   Mus musculus (house mouse): 268534
Entry
268534            CDS       T01002                                 
Symbol
Sntg2, 2210008K22Rik, 9530013L23, BB121248, G2syn, Syn5
Name
(RefSeq) syntrophin, gamma 2
  KO
K24065  gamma-syntrophin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    268534 (Sntg2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 PDZ domain-containing proteins
  Other PDZ domain-containing proteins
   268534 (Sntg2)
SSDB
Motif
Pfam: PDZ PH PDZ_6 PH_17 PDZ_2 Peptidase_M50
Other DBs
NCBI-GeneID: 268534
NCBI-ProteinID: NP_766539
MGI: 1919541
Ensembl: ENSMUSG00000020672
Vega: OTTMUSG00000024421
UniProt: Q925E0 Q8BZG8
Position
12:complement(30224481..30423424)
AA seq 539 aa
MSAEGSQSLAAPRGRPSHLLVPARTKTALALLYDEGLENAYDVRLKLTKEVLTIQKQDVV
CIGGAPPGANHRTVTLRRQPVGGLGLSIKGGAEHGVPVVISKIFKDQAADQTEMLFIGDA
VLQVNGINVENATHEEVVHLLRNAGDDVTITVEYLREAPSFLKLPLGSPGPSSDHSSRAS
SPLFDSGLHLNGHCSHTAPSSPSSPIANEPKYEKRWLDTLSVPLSMARISRYKAGTEKLR
SSALEVLALDGASTGVLQFSTAQDCADWLRSISTNISDLTLQHMKMANKCCSPCDQVVHM
GWVNERLQGADNSQNFRPKFLALRGSSFYIFGAPPVSTLDWGRAERAYNLCEVLFKVHKF
WLSDNYWLQANLYLGLQDFDCEDPRSYCFSVLANHGKSHIFSVELGSELAVWEKAFQRAT
FMEVQRTGSKTYLCSWQGETLCFTVDFALGFTCFDGKTKNVLWRFKFSQLKGSSDDGKTR
VKLLFQNLDTKQIETKELEFQDLTAVLHCIHSFIAAKVASLDPVFMDSQSMARRYLCSS
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgagcgccgagggatcgcagtccctggccgccccccgcgggcgtcctagtcacctactg
gtgcccgcgcggaccaaaacagctctggccttgttgtatgacgaggggttggaaaatgcc
tatgacgtccgcctgaagctgacaaaagaggtgctgactattcaaaagcaagatgtcgtc
tgcatcgggggagctcctcctggtgctaatcacagaactgttacacttcgcagacaacct
gtgggtggcctgggcctaagtatcaagggaggagcagagcatggggtccccgtcgtcata
tctaaaatattcaaagaccaagcagctgaccagacagagatgttgttcataggagatgct
gtactacaggttaatggcattaatgtagaaaacgcaacccatgaagaagtggtgcatctt
ctgagaaacgctggcgatgacgtcaccatcactgttgagtatctcagggaagcaccctca
tttctgaagctgccattagggtccccagggccatccagtgaccatagcagcagggcctca
tcgcctctctttgacagtggcctgcacctgaatggacactgcagccacacagctccatca
tcaccttcctcacccatagctaatgaaccaaagtatgagaagcgttggctagacaccttg
tcagtccctctgtctatggctcggatctccagatacaaagctggaacagaaaagctcagg
tccagtgcattggaggtgctggccctggatggagccagcacaggagtccttcaattctcc
actgcccaggactgtgctgactggttgcgttcaatctcaaccaacatcagtgacctgacg
cttcaacatatgaaaatggcaaataaatgctgttctccctgtgaccaggtggtgcacatg
ggatgggtaaatgagaggctccaaggagctgacaactctcagaacttcagacccaagttc
ttggccctgaggggttcatcattctacatttttggcgctcctccggtaagcacactggac
tggggacgagcagaacgtgcctataacctctgtgaggtgctgtttaaagttcacaagttc
tggctttcagataactattggctgcaggcaaacctgtatcttggtctccaagattttgac
tgtgaagaccccaggtcatactgcttcagcgtcctggccaaccatgggaagagccacatc
ttcagtgtagagctgggcagtgagctggccgtgtgggagaaggcattccaaagagcaact
ttcatggaagttcagagaaccgggtccaaaacatatctgtgcagctggcaaggggagacg
ctgtgcttcacggtggattttgctctgggattcacctgctttgacggtaagacaaagaac
gtactctggagattcaagttctctcagcttaagggatcctcagatgatgggaagactcga
gtaaagctgctgtttcagaatctggacaccaagcagattgaaacgaaggagctggagttc
caggatttgacggcggtcctccactgcatccactccttcattgccgccaaggtggcctcc
ctggaccccgtgttcatggatagccagagtatggcaagaagatacctgtgcagcagctaa

DBGET integrated database retrieval system