KEGG   Mus musculus (mouse): 268564
Entry
268564            CDS       T01002                                 

Gene name
Zbtb1, 9430077A12, AI256369, Bsg2, C430003J21Rik
Definition
(RefSeq) zinc finger and BTB domain containing 1
  KO
K10488  zinc finger and BTB domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    268564 (Zbtb1)
   04121 Ubiquitin system [BR:mmu04121]
    268564 (Zbtb1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    268564 (Zbtb1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     268564 (Zbtb1)
SSDB
Motif
Pfam: BTB zf-C2H2_4 zf-C2H2 zf-H2C2_2 zf_UBZ zf-C2H2_jaz zf-met zf-C2H2_3rep
Other DBs
NCBI-GeneID: 268564
NCBI-ProteinID: NP_848859
MGI: 2442326
Ensembl: ENSMUSG00000033454
Vega: OTTMUSG00000034943
UniProt: Q91VL9 Q5YB37
Position
12; 12 C3
AA seq 713 aa
MAKPSHSSYVLQQLNNQREWGFLCDCCIAIDDIYFQAHKAVLAACSSYFRMFFMNHQHST
AQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQLYNVPDCLEDIQDAD
CSSSKCSSSASSRQSSKMIFGVRMYEDTVARNGNEANRWCAEPSSTVNTPHHREPEEESL
QLANFPEPLFDVCKKSSVSKLSTPKERVSRRFGRSFTCDSCGFGFSCEKLLDEHVLTCTN
RHSYQNTTRAYHRIVDIRDGKDSNIKAELAEKDSSKTFSAQPDKYREDANQAPDDSASTT
GSRKSTVEAGIAGEEKSRATETKRIIIKMEPEDIPADDMKDFNIIKVTEKDCNESTDNDE
LEDEPEEPFYRYYVEEDVGIKKSGRKTLKPRMSISVDERGGLENMRPPNNTSPIQEDAEN
ASCELCGLTITEEDLSSHYLAKHIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTMNG
LGNADEKMDMEENPDEQSEIRDMFVEMLDDFRDNHYQINSIQKKQLFKHSACPFRCPNCG
QRFETENLVVEHMSSCLDQDMFKGAIMEENERDHRRKHFCNLCGKGFYQRCHLREHYTVH
TKEKQFVCQTCGKQFLRERQLRLHNDMHKGMARYVCSICDQGNFRKHDHVRHMISHLSGG
ETICQVCFQIFPNNEQLEQHMDVHLYTCGICGAKFNLRKDMRSHYNAKHLKRT
NT seq 2142 nt   +upstreamnt  +downstreamnt
atggcaaagcccagccacagcagctatgtcctgcagcagctcaacaaccaaagagagtgg
ggctttctctgtgactgctgtatcgctatcgacgacatctacttccaagcacacaaagcc
gtcctggctgcctgtagctcctactttaggatgtttttcatgaaccatcagcacagtact
gcacaactgaacctcagcaacatgaagataagtgctgagtgctttgatctcattttgcag
ttcatgtatttaggaaagatcatgaccgctccttccagtttcgagcagttcaaagtggca
atgaactacctccagctgtacaatgttcctgactgcttggaagacatacaggacgcagac
tgttctagttcaaagtgttcgtcttctgcctccagcaggcagagcagcaagatgattttt
ggggtgagaatgtatgaagacacggtggctagaaatggcaatgaagccaacaggtggtgt
gcggagcccagttcaacggtgaatacgccgcatcacagagaacctgaggaagagtctttg
cagttggccaacttccccgagccgctgtttgatgtgtgtaaaaaaagttctgtgtccaaa
ttatctactccaaaagaacgtgtgtctcgacgctttggacggagctttacctgtgatagt
tgtggatttggcttcagctgtgaaaagttactagacgaacatgtgctgacctgtaccaac
agacactcataccaaaacacgacaagagcttaccaccgaatagtagatattagagatgga
aaagatagtaacatcaaagctgaacttgctgaaaaggattcttctaaaacattttctgca
cagccggacaaatacagagaagacgccaaccaggcgcctgatgattcagcctcgaccact
ggaagcaggaaaagcaccgtggaggctgggatagctggtgaggagaaaagcagagctact
gagacaaaacgaattatcatcaagatggagccagaagatatccctgcagatgacatgaaa
gacttcaacattattaaagttactgagaaagactgcaacgagtccaccgacaatgatgaa
ttagaagatgaacccgaggagccattttatagatactatgttgaggaagatgtcggcatt
aaaaaaagtggtaggaaaaccctaaaacctcgtatgtccatcagcgtggatgagagaggt
ggcttagagaacatgagacccccgaataacaccagccccatacaagaggatgcagagaat
gcatcttgtgagctgtgtggactcacaataactgaggaggacctgtcgtctcattacttg
gccaagcacattgaaaatatctgtgcatgtggtaaatgtggacagatacttgtcaagggc
agacagcttcaggaacatgctcagaggtgcggagaaccccaggatctgacaatgaatggg
ctagggaacgctgacgagaaaatggacatggaagagaaccccgacgagcagtctgagata
agagacatgtttgttgaaatgctggatgatttcagagacaatcattaccaaataaatagt
atccagaaaaagcagttatttaaacattctgcctgtcctttccgatgtcctaattgtggc
cagcgttttgaaactgaaaatttagtggtcgaacatatgtctagctgcctagaccaagat
atgttcaagggtgccatcatggaagaaaatgaaagagatcacagaagaaaacatttttgt
aatctgtgtggaaaaggattttatcagcgctgtcatttgagagagcactatactgtgcac
actaaagaaaagcagtttgtttgtcagacatgtggaaagcagtttttaagagagcgccag
ttgcgtctacacaatgatatgcacaaaggcatggccaggtatgtctgttccatttgtgat
caaggaaacttccgaaaacatgaccatgtacggcatatgatctcgcacctgtctggtggg
gagactatatgccaggtctgctttcagatattcccaaataatgaacaactggagcagcat
atggatgtccatctgtacacgtgtggaatatgtggagcaaagtttaatttgaggaaggat
atgagatcgcattataatgccaagcatttgaaaagaacctga

DBGET integrated database retrieval system