KEGG   Mus musculus (mouse): 268566Help
Entry
268566            CDS       T01002                                 

Gene name
Gphn, 5730552E08Rik, AI662856, BC027112, C230040D23, GPH, GPHRYN, geph
Definition
(RefSeq) gephyrin
  KO
K15376  gephyrin [EC:2.10.1.1 2.7.7.75]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00790  Folate biosynthesis
mmu01100  Metabolic pathways
mmu04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    268566 (Gphn)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    268566 (Gphn)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     268566 (Gphn)
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     268566 (Gphn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MoCF_biosynth MoeA_N MoeA_C Tubulin-binding
Motif
Other DBs
NCBI-GeneID: 268566
NCBI-ProteinID: NP_766540
MGI: 109602
Ensembl: ENSMUSG00000047454
UniProt: Q8BUV3
Position
12; 12 C3
AA seq 769 aa AA seqDB search
MATEGMILTNHDHQIRVGVLTVSDSCFRNLAEDRSGINLKDLVQDPSLLGGTISAYKIVP
DEIEEIKETLIDWCDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSL
NVTPLGMLSRPVCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLRDAIVKVKEVH
DELEDLPSPPPPLSPPPTTSPHKQTEDKGVQCEEEEEEKKDSGVASTEDSSSSHITAAAL
AAKIPDSIISRGVQVLPRDTASLSTTPSESPRAQATSRLSTASCPTPKQIRRPDESKGVA
SRVGSLKARLPSCSSTYSVSEVQSRCSSKENILRASHSAVDITKVARRHRMSPFPLTSMD
KAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAADGPGDR
FIIGESQAGEQPTQTVMPGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTEELEVRI
LVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVVAVMSTG
NELLNPEDDLLPGKIRDSNRSTLLATIQEHGYPTINLGIVGDNPDDLLNALNEGISRADV
IITSGGVSMGEKDYLKQVLDIDLHAQIHFGRVFMKPGLPTTFATLDIDGVRKIIFALPGN
PVSAVVTCNLFVVPALRKMQGILDPRPTIIKARLSCDVKLDPRPEYHRCILTWHHQEPLP
WAQSTGNQMSSRLMSMRSANGLLMLPPKTEQYVELHKGEVVDVMVIGRL
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgagggaatgatcctcaccaaccacgaccatcaaatccgtgtcggagtcctc
acagtgagtgatagctgcttcaggaatcttgcagaagaccgcagtgggataaatctaaaa
gatcttgtccaagatccttctttgttgggtgggactatatcggcatacaagatagtacca
gatgaaatagaagaaatcaaggaaacactcatagactggtgtgatgaaaaggaacttaat
ttaatattaacaactggaggaacggggtttgcaccacgagatgtcactccagaggccaca
aaagaagtaatagagcgggaagcgccagggatggccctggcaatgctgatgggatcgctc
aatgtcacacctctgggcatgctctctagaccagtgtgtggaataagggggaaaactctg
ataattaacctacctggtagcaagaaaggatctcaggaatgctttcagttcatactgcca
gctctacctcatgccattgaccttttacgtgatgccattgtaaaagtaaaggaggtgcat
gatgaacttgaagatttaccttccccaccacctcctctctctccacctcctacaactagc
ccacataaacagacagaagacaaaggagttcagtgtgaagaagaggaagaagaaaagaaa
gacagtggtgtagcttcaacagaagatagttcctcatcacatataactgcagcagctctt
gctgcaaagattccagactccatcatttctcgtggtgttcaggtgctcccacgagacaca
gcctcccttagcactactccttcagaatcgccccgtgctcaggctacatctcgcctctct
acagcttcttgtccaacaccaaaacaaattagacggccggatgaaagcaaaggagttgct
agtagagttggatccctcaaagctcggcttccgtcgtgctcatctacctatagtgtatct
gaggtccagtccaggtgcagcagcaaggagaacattctaagagccagtcacagtgctgta
gatatcaccaaggtggctagaagacatcgcatgtctccttttcccctgacgtctatggac
aaagccttcattacagtcctggagatgactccggtgcttggtacagaaatcatcaattac
cgagatggaatggggcgagtccttgctcaagatgtatatgcaaaagacaacctaccccca
ttccctgcatcagtaaaagatggctatgctgttcgagctgctgatggtccaggggatcgt
ttcatcattggggaatcccaagctggtgagcagccaactcagacagtaatgccaggacaa
gtgatgcgggttacaacaggtgctccaatcccctgcggtgctgatgcagtagtgcaagtt
gaagatactgaactcatcagggaatcagatgatggtactgaagaacttgaagtacgaatt
ctggtgcaagctcggccaggccaagatatccgacccatcggccatgacattaagagaggg
gagtgtgttttggccaaaggaacccatatgggcccttcagagattggtctccttgcaact
gtgggtgtcacagaagtggaagttaataagtttccagtggttgccgttatgtcaacaggg
aatgagctgctaaatcctgaagatgatctcttaccaggaaagattcgggacagcaatcga
tcaacacttctagcaacaattcaggaacatggttacccaacaatcaacctgggaattgta
ggagacaacccagatgacttactcaatgccttgaatgagggtatcagccgtgctgatgtc
atcatcacgtcaggaggtgtgtccatgggggaaaaggactatctcaagcaggtgctggac
attgatcttcatgctcagatccattttggcagagtttttatgaagccaggcttgccaaca
acatttgcaactttggatattgatggtgtaagaaaaattatttttgcactaccagggaat
cctgtatcagctgtggtcacctgcaacctctttgttgtacctgcactgagaaagatgcag
ggtatcttggatcctcggccaaccatcatcaaagccaggttatcgtgtgatgtaaaactg
gaccctcgcccagaataccaccggtgtatactgacttggcatcaccaagaaccactgccc
tgggcccagagtacaggtaatcagatgagcagccgtctgatgagcatgcgcagtgccaat
ggattattgatgctacctccaaagacagagcagtacgtggaacttcacaaaggcgaggtg
gtagatgtcatggtcattggacggctatga

DBGET integrated database retrieval system