KEGG   Mus musculus (house mouse): 268567
Entry
268567            CDS       T01002                                 
Symbol
Tmem229b, 6330442E10Rik, 9830138K24, AU019070
Name
(RefSeq) transmembrane protein 229B
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: ABC_trans_CmpB
Other DBs
NCBI-GeneID: 268567
NCBI-ProteinID: NP_001163872
MGI: 2444389
Ensembl: ENSMUSG00000046157
UniProt: Q8BFQ2
Position
12:complement(79008569..79054333)
AA seq 167 aa
MASAEPLTALSRWYLYAIHGYFCEVMFTAAWEFVVNFNWKFPGVTSVWALFIYGTSILIV
ERMYLRLRGRCPLLVRCVIYTLWTYLWEFTTGFILRQFNACPWDYSQFDFDFMGLITLEY
AVPWFCGALIMEQFIIRNTLRLRFDKDAEPGEPASPPALANGHVKTD
NT seq 504 nt   +upstreamnt  +downstreamnt
atggcttctgccgagcccctgacagcgctgtctcgttggtacctatatgctatccacggc
tacttctgcgaggtgatgtttacagcggcctgggagtttgtggtgaattttaactggaag
ttcccgggggtcacgagcgtgtgggccctcttcatctatggcacctccatcctgatcgtg
gagcgtatgtaccttcgtctgcgtggccgctgtcctcttctggtgcgctgcgtcatctac
actctctggacttacctgtgggaattcaccaccggctttatcctacgccagttcaacgcc
tgtccctgggactactcccagttcgactttgatttcatgggcctcattaccctggagtat
gctgtgccctggttctgcggggccctcatcatggagcagtttatcatccgcaacaccctc
cgcctgcgctttgacaaggacgcagagcctggggagcctgccagcccaccagccctggcc
aatggccacgtcaagaccgactga

DBGET integrated database retrieval system