KEGG   Mus musculus (mouse): 268656
Entry
268656            CDS       T01002                                 

Gene name
Sptlc1, AW552086, C77762, E030036H05, Lcb1, SPT1
Definition
(RefSeq) serine palmitoyltransferase, long chain base subunit 1
  KO
K00654  serine palmitoyltransferase [EC:2.3.1.50]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00600  Sphingolipid metabolism
mmu01100  Metabolic pathways
mmu04071  Sphingolipid signaling pathway
Module
mmu_M00094  Ceramide biosynthesis
mmu_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    268656 (Sptlc1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    268656 (Sptlc1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    268656 (Sptlc1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     268656 (Sptlc1)
Amino acid related enzymes [BR:mmu01007]
 Aminotransferase (transaminase)
  Class II
   268656 (Sptlc1)
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP
Other DBs
NCBI-GeneID: 268656
NCBI-ProteinID: NP_033295
MGI: 1099431
Ensembl: ENSMUSG00000021468
UniProt: O35704
Position
13; 13 B1
AA seq 473 aa
MATVAEQWVLVEMVQALYEAPAYHLILEGILILWIIRLVFSKTYKLQERSDLTAKEKEEL
IEEWQPEPLVPPVSKNHPALNYNIVSGPPTHNIVVNGKECVNFASFNFLGLLANPRVKAT
AFSSLKKYGVGTCGPRGFYGTFDVHLDLEERLAKFMKTEEAIIYSYGFSTIASAIPAYSK
RGDIIFVDSAACFAIQKGLQASRSDIKLFKHNDVADLERLLKEQEIEDQKNPRKARVTRR
FIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGISIDDI
DLISANMENALASVGGFCCGRSFVVDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENP
DIFAVLKKKCQNIHKSLQGVSGLKVVGESLSPALHLQLEESTGSREKDVKLLQAIVDQCM
DKGIALTQARYLDKEEKCLPPPSIRVVVTVEQTEEELQRAASTIREAAQAVLL
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggcgacagtggcggagcagtgggtgctggtggagatggtgcaggcgctgtacgaggct
ccagcataccatcttattttggaaggaatcctaatactttggataatcagactcgttttc
tctaaaacttacaagttgcaggagcgttctgatcttacagccaaggaaaaggaagaactg
attgaagagtggcagccagagcccctcgtccctccagtctccaagaaccaccctgctctc
aactacaacatcgtgtccggccctccaacccacaacatcgtggtgaatggaaaagagtgt
gtcaactttgcctcctttaacttccttgggctgctggccaaccctcgagttaaggccaca
gctttttcatctttaaagaagtacggagtgggtacctgtggtcctcgagggttctatggc
acatttgatgtccatctggatttagaagagcgcctggcaaagtttatgaagaccgaagaa
gccatcatttactcgtatggcttctccaccatagccagtgccattcctgcgtactctaag
agaggggacatcatctttgtggacagtgcggcctgctttgctatccagaaaggattacag
gcatcaagaagtgacattaagttatttaagcataatgatgtggctgacctggagcgactg
ctaaaagaacaagagattgaagatcaaaagaatcctcgcaaggcccgtgtgactcggcgg
ttcatcgtggtggagggcttgtacatgaacactggaaccatctgtccccttccagaactg
gttaaattaaaatataaatataaagcaagaatattcctggaggagagcctgtcctttgga
gtccttggggagcacgggcgaggagtcaccgagcactatgggatcagtattgatgatatt
gaccttatcagtgctaacatggagaatgcactcgcttctgtcgggggcttctgctgtggc
cgctccttcgtggttgaccatcagcggctctccggtcaaggatactgcttttctgcttcg
ttacctcccctgctagctgctgctgccattgaggccctcaacatcatggaagagaatcca
gatatttttgcagttttaaagaaaaaatgccagaacatccataagtctctacaaggtgtt
tcgggtttaaaagtggtgggagagtccctttctccggcgcttcatctccagctggaagag
agcacgggctctcgggagaaagatgtgaagctgcttcaagcaatcgtagatcagtgcatg
gataagggcatcgcattgactcaggcacggtacttggacaaggaagagaagtgccttcct
cctccaagcatcagggttgtggtcactgtggagcagacggaggaagagctacagagggct
gcatccaccatcagggaggcggcccaggctgtgctgttgtag

DBGET integrated database retrieval system