KEGG   Mus musculus (mouse): 268697
Entry
268697            CDS       T01002                                 

Gene name
Ccnb1, Ccnb1-r, Ccnb1-rs1, Ccnb1-rs13, CycB1, Cycb-4, Cycb-5, Cycb1-rs1
Definition
(RefSeq) cyclin B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04115  p53 signaling pathway
mmu04218  Cellular senescence
mmu04914  Progesterone-mediated oocyte maturation
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    268697 (Ccnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    268697 (Ccnb1)
   04114 Oocyte meiosis
    268697 (Ccnb1)
   04115 p53 signaling pathway
    268697 (Ccnb1)
   04218 Cellular senescence
    268697 (Ccnb1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    268697 (Ccnb1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    268697 (Ccnb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    268697 (Ccnb1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    268697 (Ccnb1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    268697 (Ccnb1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    268697 (Ccnb1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Trypan_PARP
Other DBs
NCBI-GeneID: 268697
NCBI-ProteinID: NP_758505
MGI: 88302
Ensembl: ENSMUSG00000041431
Vega: OTTMUSG00000020969
UniProt: P24860 Q3TQW9
Position
13 D1; 13 53.23 cM
AA seq 430 aa
MALRVTRNTKINAENKAKVSMAGAKRVPVTVTAASKPGLRPRTALGDIGNKVSEELQARV
PLKREAKTLGTGKGTVKALPKPVEKVPVCEPEVELAEPEPEPELEHVREEKLSPEPILVD
NPSPSPMETSGCAPAEEYLCQAFSDVILAVSDVDADDGADPNLCSEYVKDIYAYLRQLEE
EQSVRPKYLQGREVTGNMRAILIDWLIQVQMKFRLLQETMYMTVSIIDRFMQNSCVPKKM
LQLVGVTAMFIASKYEEMYPPEIGDFAFVTNNTYTKHQIRQMEMKILRVLNFSLGRPLPL
HFLRRASKVGEVDVEQHTLAKYLMELSMLDYDMVHFAPSQIAAGAFCLALKILDNGEWTP
TLQHYLSYSEDSLLPVMQHLAKNVVMVNCGLTKHMTVKNKYAASKHAKISTLAQLNCTLV
QNLSKAVTKA
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggcgctcagggtcactaggaacacgaaaattaacgcagaaaataaggccaaggtcagt
atggcaggcgccaagcgtgtgcctgtgacagttactgctgcttccaagcccgggctgaga
ccgagaactgctcttggagacattggtaataaagtcagcgaagagctacaggcaagagtg
cctctgaaaagggaagcaaaaacgctaggtactggaaaaggtactgttaaagccctacca
aaacctgtagagaaggtgcctgtgtgtgaaccagaggtggaacttgctgagcctgagcct
gaacctgaacttgaacatgttagagaagagaagctttctcctgaacctattttggttgat
aatccctctccaagcccgatggaaacatctggatgtgcgcctgcagaagagtatctgtgt
caggctttctctgatgtaatccttgcagtgagtgacgtagacgcagatgatggggctgac
ccaaacctctgtagtgaatatgtgaaagatatctatgcttatctccgacaactggaggaa
gagcagtcagttagaccaaaatacctacagggtcgtgaagtgactggaaacatgagagct
atcctcattgactggctaatacaggttcagatgaaatttaggctgcttcaggagaccatg
tacatgactgtgtccattattgatcggttcatgcagaacagttgtgtgcccaagaagatg
ctacagctggtcggtgtaacggccatgtttattgcaagcaaatatgaggagatgtaccct
ccagaaataggtgacttcgcctttgtgactaacaacacgtacactaagcaccagatcaga
cagatggagatgaagattctcagagttctgaacttcagcctgggtcgccctctgcctctg
cacttcctccgtagagcatctaaagtcggagaggttgacgtcgagcagcacactttggcc
aaatacctcatggagctctccatgctggactacgacatggtgcattttgctccttctcaa
attgcagctggggctttctgcttagcgctgaaaattcttgacaacggtgaatggacacca
actctgcagcactacctatcctacagtgaagactccctgcttcctgttatgcagcacctg
gctaagaatgtagtcatggtgaactgtggcctcacaaagcacatgactgtcaagaacaag
tatgcagcatctaagcatgctaagatcagcacgctggcacagctgaactgtacactagtt
cagaatttgtctaaggccgtgacaaaggcataa

DBGET integrated database retrieval system