KEGG   Mus musculus (mouse): 26874Help
Entry
26874             CDS       T01002                                 

Gene name
Abcd2, ABC39, ALDL1, ALDR, ALDRP
Definition
(RefSeq) ATP-binding cassette, sub-family D (ALD), member 2
  KO
K05676  ATP-binding cassette, subfamily D (ALD), member 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    26874 (Abcd2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    26874 (Abcd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    26874 (Abcd2)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCD (ALD) subfamily
   ABCD2 subgroup
    26874 (Abcd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane_2 ABC_tran AAA_21 AAA_23 Rad17 AAA_29 RVP SMC_N ARID Adeno_IVa2 AAA_27
Motif
Other DBs
NCBI-GeneID: 26874
NCBI-ProteinID: NP_036124
MGI: 1349467
Ensembl: ENSMUSG00000055782
UniProt: Q61285 A0A0R4J0U5
Position
15; 15 E3
AA seq 741 aa AA seqDB search
MIHMLNAAAYRVKWTRSGAAKRAACLVAAAYALKTLYPIIGKRLKQPGHRKAKAEAYSPA
ENREILHCTEIICKKPAPGLNAAFFKQLLELRKILFPKLVTTETGWLCLHSVALISRTFL
SIYVAGLDGKIVKSIVEKKPRTFIIKLIKWLMIAIPATFVNSAIRYLECKLALAFRTRLV
DHAYETYFANQTYYKVINMDGRLANPDQSLTEDIMMFSQSVAHLYSNLTKPILDVILTSY
TLIRTATSRGASPIGPTLLAGLVVYATAKVLKACSPKFGSLVAEEAHRKGYLRYVHSRII
ANVEEIAFYRGHKVEMKQLQKCYKALAYQMNLILSKRLWYIMIEQFLMKYVWSSCGLIMV
AIPIITATGFADGDLEDGPKQAMVSDRTEAFTTARNLLASGADAIERIMSSYKEITELAG
YTARVYNMFWVFDEVKRGIYKRTVTQEPENHSKRGGNLELPLSDTLAIKGTVIDVDHGII
CENVPIITPAGEVVASRLNFKVEEGMHLLITGPNGCGKSSLFRILSGLWPVYEGVLYKPP
PQHMFYIPQRPYMSLGSLRDQVIYPDSADDMREKGYTDQDLERILHSVHLYHIVQREGGW
DAVMDWKDVLSGGEKQRMGMARMFYHKPKYALLDECTSAVSIDVEGKIFQAAIGAGISLL
SITHRPSLWKYHTHLLQFDGEGGWRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNE
LCKILGEDSVLKTIQTAEKTS
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgatacacatgctaaatgcagcagcctatcgggtgaaatggaccagatccggtgctgct
aaaagggctgcctgcctggtggctgcggcatatgctctgaaaaccctctatcccatcatt
ggcaagcgtttaaagcagcctggccacaggaaggcaaaagcagaagcttactcgcctgca
gagaacagagaaatactgcattgcacggagatcatctgtaaaaaacctgcgccgggacta
aatgcagcttttttcaaacagctactagaacttcggaaaatcctctttccaaaacttgtg
accactgaaacggggtggctctgcctccactcggtggctctaatctcaagaacatttctc
tctatttatgtggctggtctggatgggaaaatcgtgaaaagcatcgtggaaaagaagcct
cggactttcatcatcaaattaatcaagtggcttatgattgctatccctgctacctttgtc
aacagtgctatcaggtacctggaatgcaaactggcattggcctttagaactcgcttagta
gaccatgcctatgagacctatttcgcaaatcagacttattataaggtgataaatatggat
gggaggctggcaaaccctgaccagtctcttaccgaagacattatgatgttctcgcaatct
gtggctcacctgtattccaaccttaccaaacctattttagatgtcattctaacctcctat
actctcatccggacagctacatccagaggagcaagccctatagggcccaccctgttagca
ggacttgtcgtgtatgccactgctaaagtactgaaagcttgctcgcccaaatttggttcg
ctggtggctgaagaagcccacaggaaaggctacctgcggtatgtccactcccgaatcata
gccaatgtagaagaaattgccttctacagaggacataaggtagaaatgaagcagctgcag
aaatgttacaaggctttagcttaccagatgaacctgattttatccaaacgtttatggtac
atcatgatagaacaattcttgatgaagtatgtgtggagcagctgtggactaattatggtg
gctatacccattatcactgcaacgggctttgcagatggtgatctggaggatggtccaaag
caggctatggttagcgatcggacagaggccttcaccactgcccggaacttactggcctct
ggagctgatgcaattgaaaggattatgtcttcatacaaagagatcactgaactagcaggt
tatactgctagagtatacaatatgttctgggtcttcgatgaagtgaagagaggcatttat
aagagaactgtcactcaggaacctgaaaaccatagcaagcgtggaggtaacctggaacta
cccctcagcgacaccctggccatcaaaggaacagttattgatgtggatcatggaatcatt
tgtgaaaatgttcccataattacaccagcgggcgaagtggtggcttccaggctaaacttc
aaagtggaagaagggatgcatctcttgataactggtcccaacggttgtgggaaaagctct
ctcttcagaatcttaagcgggctgtggcctgtgtatgaaggagtcctttataaaccgcct
ccccaacatatgttctatattccacagaggccatacatgtctcttggaagtctccgggat
caagtaatttaccctgactcagcggatgacatgcgtgagaaaggttacactgaccaagac
ctagaacgcatcctgcacagcgtgcacctctaccacatagttcaaagagaaggaggatgg
gatgcagtcatggactggaaagatgtcctttccggaggggagaagcagagaatgggcatg
gcgcggatgttttaccataaaccgaagtatgcattgctggatgaatgtaccagtgccgtg
agcatcgacgttgaaggaaagatatttcaggctgctattggggctgggatttccctactc
tccataacacacaggccttctctgtggaaataccacactcatctattacaattcgatggc
gaaggaggctggcgctttgaacagttggacactgctatccgtttaacgttgagtgaggaa
aagcaaaagttggagtcgcagctcgctggaattcccaaaatgcaacagagactcaacgaa
ctatgcaaaattctgggggaagactcggtgctgaaaacaatccaaactgcagaaaagaca
tcctaa

DBGET integrated database retrieval system