KEGG   Mus musculus (house mouse): 268756
Entry
268756            CDS       T01002                                 
Symbol
Gulo, 5730581M22, AU018375, BC028822, GLO, LGO, sfx, unh, unhip
Name
(RefSeq) gulonolactone (L-) oxidase
  KO
K00103  L-gulonolactone oxidase [EC:1.1.3.8]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00053  Ascorbate and aldarate metabolism
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Module
mmu_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    268756 (Gulo)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.8  L-gulonolactone oxidase
     268756 (Gulo)
SSDB
Motif
Pfam: ALO FAD_binding_4 zf_C2H2_ZHX B12-binding
Other DBs
NCBI-GeneID: 268756
NCBI-ProteinID: NP_848862
MGI: 1353434
Ensembl: ENSMUSG00000034450
UniProt: P58710
Position
14:complement(66224235..66246703)
AA seq 440 aa
MVHGYKGVQFQNWAKTYGCSPEMYYQPTSVGEVREVLALARQQNKKVKVVGGGHSPSDIA
CTDGFMIHMGKMNRVLQVDKEKKQVTVEAGILLTDLHPQLDKHGLALSNLGAVSDVTVGG
VIGSGTHNTGIKHGILATQVVALTLMKADGTVLECSESSNADVFQAARVHLGCLGVILTV
TLQCVPQFHLLETSFPSTLKEVLDNLDSHLKKSEYFRFLWFPHSENVSIIYQDHTNKEPS
SASNWFWDYAIGFYLLEFLLWTSTYLPRLVGWINRFFFWLLFNCKKESSNLSHKIFSYEC
RFKQHVQDWAIPREKTKEALLELKAMLEAHPKVVAHYPVEVRFTRGDDILLSPCFQRDSC
YMNIIMYRPYGKDVPRLDYWLAYETIMKKFGGRPHWAKAHNCTRKDFEKMYPAFHKFCDI
REKLDPTGMFLNSYLEKVFY
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggtccatgggtacaaaggggtccagttccaaaactgggcgaagacctatggctgcagt
ccagagatgtactaccagcccacatcagtgggggaggtcagagaggtgctggccctggcc
cggcagcagaacaagaaagtgaaggtggtgggtggcggccactcgccttcagacatcgcc
tgcaccgatggcttcatgattcacatgggcaagatgaaccgggttctccaggtggacaag
gagaagaagcaggtcacagtggaagccggtatcctcctgactgacctgcacccacagctg
gacaagcatggcctggccctgtctaatctgggagccgtgtctgatgtgacggttggtggc
gtcattgggtctggaacacataacaccgggatcaagcacggtatcctggccacccaggtg
gtggccctgaccctgatgaaggctgatggaacagttctggaatgttctgagtcaagtaat
gcagatgtgttccaggctgcaagggtgcacctgggctgcctgggtgttatcctcactgtc
accctgcagtgtgtgccacagttccaccttctggagacatcctttccttcgaccctcaag
gaggtccttgacaacctggacagccacctgaagaagtctgagtacttccgcttcctctgg
tttcctcacagtgagaacgtcagcatcatctaccaagatcacaccaacaaggagccctcc
tctgcatctaactggttttgggactatgccattgggttctacctcctggaattcttgctc
tggaccagcacctacctgccacgcctcgtgggctggatcaaccgcttcttcttctggctg
ctgttcaactgcaagaaggagagcagcaacctcagccacaagatcttctcctacgagtgt
cgcttcaagcagcatgtccaagactgggccatccccagggagaagaccaaggaggccctg
ctggagctaaaggccatgctggaggcccaccccaaggtggtagcccactaccccgtggag
gtgcgcttcacccgaggtgatgacatcctgctgagcccgtgcttccagagggacagctgc
tacatgaacatcattatgtacaggccctatgggaaggatgtgcctcggttggattactgg
ctggcctatgagaccatcatgaagaagtttggaggcaggccccactgggcaaaggcccac
aattgcaccaggaaggactttgagaaaatgtaccccgcctttcacaagttctgtgacatc
cgcgagaagctggaccccactggaatgttcttgaattcgtacctggaaaaggttttctac
taa

DBGET integrated database retrieval system