KEGG   Mus musculus (mouse): 268759
Entry
268759            CDS       T01002                                 

Symbol
9930012K11Rik
Name
(RefSeq) RIKEN cDNA 9930012K11 gene
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF4657
Other DBs
NCBI-GeneID: 268759
NCBI-ProteinID: NP_001106206
MGI: 2145726
Ensembl: ENSMUSG00000044551
Vega: OTTMUSG00000032872
UniProt: Q66JV7
Position
14; 14 D2
AA seq 365 aa
MLSRRRVFAVERLGGRDGAFEDLAQGCVVPGVTCTYRRIPDNTHECSLDFREGQNELRGL
ERQMPLLKLASQDSGMEMVVGDSSLATLSGLSQDSLNLEPMGSPELPPAQLDRLLARQKL
EEVLERSREFPSLSAQRGPLQLLNKPVDGVPIFAGEQESTEADTELEAGLEEAKEVGNME
SAACTCLPGQGLRYLEHLCLVLEQMVRLQQLYLQLQTQRPSRDPEEEVLAPALSSSHIPD
NRVQEHREELSQTKDPEGAEAASLPEVGVLVTSPSRLPEALLEPTHILPPSQEPKDLSHW
DKVKVLLNRLRWRSPRLPEPPVPPDGSGSRMEFRNLSDRTPCHSQRKTFIPALVVKKPRA
KNLSV
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctgagccggcgccgcgtctttgcggtggagcgacttggcggccgggatggggccttt
gaggacctggcacaaggctgtgtggtgccaggagtcacttgcacctacagacggatacca
gacaacactcacgaatgttcactggacttcagggagggacagaatgagctgagaggtctg
gagagacagatgccacttctgaaactggcttcccaggactcgggcatggagatggttgtt
ggggacagctccttggctaccttatcaggactttctcaagattctctgaaccttgagccc
atggggagccctgagctgcctcctgctcagctagaccggctgctggccagacagaagctg
gaggaggtgctggagagatctcgagagtttcccagcttgtctgcgcagcgtggccccctg
caactgctgaacaagcctgtagatggagtgcccatctttgcaggagaacaggagtccacg
gaggcagacactgagctagaggctggtctggaagaagcaaaggaggttggtaatatggag
tctgcagcctgtacctgccttccaggtcagggcttgcgctatctggaacacctgtgcctt
gtgctggagcagatggtgaggctccagcagctgtacctgcagctgcagacccagagaccc
tctagggatcctgaggaggaagtattggctccagctctttcatcatcacatatcccagac
aatagggtccaggagcacagagaggagctaagccagacaaaggacccagaaggtgcagag
gcagcttcacttccagaagtgggggtgcttgtcaccagcccctctaggctgccagaggcc
ttgctggaaccaacccacatccttccaccctcccaggaacccaaggatctctcccactgg
gataaggtcaaagttctgctcaatcggctccgttggaggagccctcgacttcctgagcct
cctgttccccctgatggttctggatccaggatggagtttagaaacctctctgacaggact
ccgtgccattcccaacggaagacctttataccagcattggtggttaagaagccacgagca
aaaaatctttctgtatga

DBGET integrated database retrieval system