KEGG   Mus musculus (house mouse): 26877
Entry
26877             CDS       T01002                                 
Symbol
B3galt1, beta3Gal-T1
Name
(RefSeq) UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1
  KO
K07819  beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00601  Glycosphingolipid biosynthesis - lacto and neolacto series
mmu01100  Metabolic pathways
Module
mmu_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    26877 (B3galt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    26877 (B3galt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     26877 (B3galt1)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  Type 1 chain
   26877 (B3galt1)
SSDB
Motif
Pfam: Galactosyl_T B3GALT2_N
Other DBs
NCBI-GeneID: 26877
NCBI-ProteinID: NP_064679
MGI: 1349403
Ensembl: ENSMUSG00000034780
Position
2:67395528..67953226
AA seq 326 aa
MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTFGNIRTRPINP
HSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGK
NADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDI
FVNMDNLIYKLLKPSTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTG
YIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRV
ITVHQISPEEMHRIWNDMSSKKHLRC
NT seq 981 nt   +upstreamnt  +downstreamnt
atggcttcaaaggtctcctgcctctatgtattgaccgttgtgtgctgggccagcgctctc
tggtacttgagcataaccagacctacttcatcctacactggctccaagccgttcagtcac
ctaacagttgccaggaaaaacttcacctttggcaacataagaactcgacctataaaccca
cattcttttgaatttctgataaatgagcccaacaagtgcgagaaaaacattccttttctc
gtgatcctcattagcaccacacacaaggaatttgatgcccgccaggcaatccgggagaca
tggggggatgaaaacaacttcaaagggatcaagatagccacacttttcctcctgggcaaa
aatgctgatcctgttctgaaccagatggtggagcaagagagccagatcttccatgacatc
atcgtggaggacttcattgactcctaccacaatctcaccctcaaaaccttaatggggatg
agatgggttgccactttctgttcaaaagccaagtacgtcatgaaaaccgacagtgacatt
tttgtgaacatggacaaccttatttataaactcctgaaaccctctaccaagccaagaaga
aggtatttcactggttacgtcatcaacggcgggccaatcagggatgtccgcagtaagtgg
tatatgcctagagatttgtaccctgacagcaactacccaccgttctgttcagggactggc
tatatcttttccgctgatgtggctgaactcatttacaagacctcgctccacaccaggctg
cttcatcttgaagatgtgtacgtgggactgtgtcttcgaaagcttggcatccatcctttc
cagaatagtggcttcaatcactggaaaatggcctacagtttgtgtcggtaccgccgcgtc
atcactgtccaccagatctctccagaagaaatgcacagaatctggaatgacatgtcaagc
aagaagcatctgagatgttag

DBGET integrated database retrieval system