KEGG   Mus musculus (mouse): 26878
Entry
26878             CDS       T01002                                 

Symbol
B3galt2
Name
(RefSeq) UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2
  KO
K07820  beta-1,3-galactosyltransferase 2 [EC:2.4.1.86]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00601  Glycosphingolipid biosynthesis - lacto and neolacto series
mmu01100  Metabolic pathways
Module
mmu_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    26878 (B3galt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    26878 (B3galt2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     26878 (B3galt2)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  Type 1 chain
   26878 (B3galt2)
SSDB
Motif
Pfam: Galactosyl_T
Other DBs
NCBI-GeneID: 26878
NCBI-ProteinID: NP_064409
MGI: 1349461
Ensembl: ENSMUSG00000033849
Vega: OTTMUSG00000030947
UniProt: O54905
Position
1; 1 F
AA seq 422 aa
MLQWRRRHCCFAKMTWSPKRSLLRTPLTGVLSLVFLFAMFLFFNHHDWLPGRPGFKENPV
TYTFRGFRSTKSETNHSSLRTIWKEVAPQTLRPHTASNSSNTELSPQGVTGLQNTLSANG
SIYNEKGTGHPNSYHFKYIINEPEKCQEKSPFLILLIAAEPGQIEARRAIRQTWGNETLA
PGIQIIRVFLLGISIKLNGYLQHAIQEESRQYHDIIQQEYLDTYYNLTIKTLMGMNWVAT
YCPHTPYVMKTDSDMFVNTEYLIHKLLKPDLPPRHNYFTGYLMRGYAPNRNKDSKWYMPP
DLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLEDVYVGICLAKLRVDPVPPPN
EFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRK
LH
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgcttcagtggagaagacgacactgctgctttgcaaaaatgacctggagccctaagagg
tctctgctccggactccccttacgggtgtgctttctctagtgtttctctttgctatgttc
ttgtttttcaatcatcatgactggttaccaggtagaccaggattcaaagaaaatcctgtg
acatacactttccgaggatttcgttctacaaaaagtgagacaaaccatagctcccttcgg
accatctggaaagaagtagctcctcagactctgaggcctcacacagcaagcaactccagt
aacaccgagctatcaccacagggagtcacagggctgcagaacactctcagtgccaatggc
agcatttataatgaaaaaggaactggacatccaaactcttaccatttcaaatatattatc
aatgagcctgaaaaatgccaagagaaaagtccatttttaatactattaatagctgcagaa
cctggacaaatcgaagcaagaagagctatacggcaaacttggggcaatgaaactttggca
cctggcatccaaatcatacgggtttttttgttgggcataagtattaagctaaatggctat
cttcaacatgcaattcaagaagaaagcagacagtatcatgatataattcagcaggaatat
ttagatacatactataatctgaccattaaaacactaatgggtatgaactgggttgcaaca
tactgtccacatactccctatgttatgaaaacggacagtgacatgtttgtcaacacagaa
tacttaatacacaagttactaaagccagacctgcctcctagacataactattttactggc
tatctaatgagaggatatgcaccgaacagaaacaaagacagtaagtggtacatgccacca
gacctttacccaagtgagcgctaccctgtcttctgctcaggaactggttatgtgttttct
ggggatctggcagagaagatatttaaggtttctttaggtatccgtcgtttgcacttggaa
gatgtatatgtagggatctgtcttgccaagttgagagttgatcctgtgccccctcccaat
gagttcgtgttcaatcactggcgagtttcttattcaagctgtaaatacagccacctaatt
acctctcatcagttccaacctagtgaactgataaaatactggaaccatttacaacaaaat
aagcacaacgcctgtgccaatgcagcaaaggaaaaggcaggcaggtatcgacaccgcaaa
ctacactag

DBGET integrated database retrieval system