KEGG   Mus musculus (mouse): 268782Help
Entry
268782            CDS       T01002                                 

Gene name
Agxt2, AI303810, AI663818
Definition
(RefSeq) alanine-glyoxylate aminotransferase 2
  KO
K00827  alanine-glyoxylate transaminase / (R)-3-amino-2-methylpropionate-pyruvate transaminase [EC:2.6.1.44 2.6.1.40]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00250  Alanine, aspartate and glutamate metabolism
mmu00260  Glycine, serine and threonine metabolism
mmu00270  Cysteine and methionine metabolism
mmu00280  Valine, leucine and isoleucine degradation
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    268782 (Agxt2)
   00260 Glycine, serine and threonine metabolism
    268782 (Agxt2)
   00270 Cysteine and methionine metabolism
    268782 (Agxt2)
   00280 Valine, leucine and isoleucine degradation
    268782 (Agxt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    268782 (Agxt2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.40  (R)-3-amino-2-methylpropionate---pyruvate transaminase
     268782 (Agxt2)
    2.6.1.44  alanine---glyoxylate transaminase
     268782 (Agxt2)
Amino acid related enzymes [BR:mmu01007]
 Aminotransferase (transaminase)
  Class III
   268782 (Agxt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 268782
NCBI-ProteinID: NP_001297664
MGI: 2146052
Ensembl: ENSMUSG00000089678
Vega: OTTMUSG00000024223
UniProt: Q3UEG6
Position
15; 15 A1
AA seq 513 aa AA seqDB search
MSLAWRNLQKPFYLETSLRILQMRPSLSLGASRIAVPKLTLHTKHSMPPCDFSPEKYQSL
AYSRVLAIHKQHLSPVDTAYFRKPLLLHQGHMEWLFDSEGNRYLDFFSGIVTVSVGHCHP
KVSAVAKKQIDRLWHTSSVFFHSPMHEYAEKLSALLPEPLKVIFLVNSGSEANDLAMVMA
RAHSNHTDIISFRGAYHGCSPYTLGLTNVGIYKMEVPGGIGCQSTMCPDVFRGPWGGIHC
RDSPVQTVRDCSCAPDCCQAKERYIEQFKDTLNTSVATSIAGFFAEPIQGVNGVVQYPKE
FLKEAFALVRERGGVCIADEVQTGFGRLGSHFWGFQTHDVLPDIVTMAKGIGNGFPMAAV
VTTPEIAKSLAKRLLHFSTFGGNPLACAIGSAVLEVIEEENLQRNSQEVGTYMLLKFAKL
RDEFDIVGDVRGKGLMVGIEMVQDKISRQPLPKTEVNQIHEDCKDMGLLVGRGGNFSQTF
RIVPPMCVTKMEVDFAYEVFRAALIQHMERRAK
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtctctagcctggagaaatttgcagaaacccttttatctggagacttctctcagaata
ctccagatgcgtccatccctgagcttaggtgcttcccggatagctgtgcccaagctcact
cttcatacaaagcacagcatgccaccgtgtgacttctcacctgagaaataccagtccctg
gcctacagccgtgtgctggcgattcacaagcagcatctttctcctgtggatacagcctat
ttccggaagcctttgctactccaccagggacacatggagtggctctttgattctgaggga
aacagatacctggacttcttctctgggattgtcactgttagtgttggtcactgccacccg
aaggtaagtgcagtggcaaaaaaacagatagaccgcctgtggcatacaagttctgtcttc
ttccactctccgatgcatgaatatgcagagaagctctcagcactccttcctgagcctctt
aaggtcattttcttggtgaacagtggatcagaagccaacgacctggccatggtgatggcc
cgagcacactcgaatcacacagacatcatatctttcagaggagcctatcacggatgcagt
ccctatacacttggcctgacaaatgtcggaatctacaagatggaagtccctggtgggata
ggctgccaatcaacaatgtgcccagatgttttccgtggcccttggggaggaatccattgt
cgagattctccagtgcaaacagtgagggactgcagctgtgctccagactgctgccaagct
aaagaacggtatatcgaacaattcaaagacacactgaacacttctgtggccacatcaatt
gctggattttttgcagagccaattcaaggtgtgaatggtgttgtccagtacccaaaggag
tttctgaaggaagcctttgcgttggtccgagagcggggaggtgtgtgcatcgcagatgaa
gtgcagacaggctttggcaggctgggctctcacttctggggtttccagacacatgatgta
cttcctgacattgtcaccatggctaaagggattggaaatggcttccccatggctgcagtt
gtgaccactccagaaattgcgaagtctttggctaaacgtttgcttcacttcagcacattt
ggaggaaatcccctggcctgcgccattggatctgctgtgcttgaggtgattgaagaagaa
aatctccagagaaacagtcaagaagttggcacctacatgctgctgaagtttgctaagctt
cgggacgaatttgatatcgttggggatgtccgaggcaaaggccttatggtggggatagag
atggttcaagacaagataagccgacaacctcttcctaaaacagaagtcaatcaaatccat
gaggactgcaaagacatggggctcctagtgggtagaggtggtaatttttctcagactttt
cgaattgtgcccccgatgtgtgtcacgaagatggaagtagattttgcatatgaagtattt
cgagctgccttaattcaacacatggagagaagagctaagtaa

DBGET integrated database retrieval system