KEGG   Mus musculus (mouse): 268783
Entry
268783            CDS       T01002                                 

Symbol
Mtmr12, 3Pap, 4932703C11, C730015A02Rik, P, Pip3ap, mKIAA1682
Name
(RefSeq) myotubularin related protein 12
  KO
K18085  myotubularin-related protein 10/11/12
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    268783 (Mtmr12)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    268783 (Mtmr12)
SSDB
Motif
Pfam: Myotub-related 3-PAP
Other DBs
NCBI-GeneID: 268783
NCBI-ProteinID: NP_766546
MGI: 2443034
Ensembl: ENSMUSG00000039458
Vega: OTTMUSG00000037061
UniProt: Q80TA6
Position
15; 15 A1
AA seq 747 aa
MLGKGGVGGGGGTKAPKPSFVSYVRPEEIHTDEKEVTEKEVTLHLLPGEQLLCEASTVLK
YVQEDSCQRGVYGRLVCTDFKISFLGDEDSALDNGGEAQFKNKIIGVNDVPLHCVDQIYG
VFDEKKKPLFGQLKKYPEKLVIHCKDLRVLHFCLRYTKEEEVKRIVSGIIHHTQSPKLLK
RLFLFSYAAAVHGTATDSRNCTVMFDTPKDWCWELERTKGSVKYRTVSVNEGYRVSDRLP
AYFVVPTPLPEDDVRRFQGHGIPIWCWSCHNGSALLKMSALPKEQDDGALQVQKSFLDGI
YKTIHRPPYEMVKTEDLSSNFLSLQEIQSAYCKFKQLFLIDNSSEFWDTDIKWFSLLESS
SWLDIIRRCLKKAIEITECLEAQNVNVLLLEENASDLCCLLSSLVQVMMDAHCRTRTGFQ
SLIQKEWVMGGHSFLDRCNHLHQSDKEEVPIFLLFLDCVWQLVHQYPPAFEFTETYLTVL
SDSLYIPIFSTFFFNSPHQKDTNMGRENLDAQSKPLTLLTVWDWSVQFEPKAQTLLRNPL
YVEKPKLDRGQQKGSRFKHQRQLSLPLTQSKSSPKRGFFREETDHLIKNLLGKRISKLIN
SSDDLQDSSREFYDSWHSKPTDYHGLLLPHIEGPEIKVWAQRYLRWIPEAQILGGGRVAT
MGKLLEMMEEVQSLQEKIEARHHRQEAVHAEAPGLLRNSVRLSSLFPFALLQRHSAKPVL
PTSGWKALGGEDDLAKREDEFVDLGDV
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgctggggaaagggggagtcggcggtggcggcggcaccaaggcgcccaagccctccttc
gtgtcgtacgtacgccctgaggaaattcacacagatgaaaaggaagtaacagagaaggaa
gtcactcttcacttgttgccaggtgaacagctgctttgtgaagccagcacagtcctgaag
tatgtgcaggaagattcgtgtcagcgcggcgtctatgggagactcgtgtgcactgacttc
aagatttccttcctgggggacgaggactcggccctggataatggcggggaagctcagttt
aagaataagatcataggagtaaatgacgtgccactgcactgtgtggatcagatttatgga
gtgtttgatgagaaaaagaaacctctgtttggacaactgaagaagtaccccgagaagctc
gttatccattgcaaagacctgcgggtgctccacttctgtctgaggtacacaaaggaggag
gaagtcaaaaggatcgtcagtggcataatccatcatacccagagccccaaactgctgaaa
agactgtttctgttctcctacgccgctgctgtgcacggcactgccactgattccaggaac
tgtactgtaatgtttgacactccgaaagactggtgttgggagctggagcggaccaagggt
agtgtgaagtacagaacagtgagtgtgaatgaaggctaccgagtctctgacaggttgcca
gcatacttcgttgtccccactccccttccggaagacgatgtgaggcgttttcagggccat
ggtataccaatctggtgttggtcctgtcacaatggaagtgcccttttgaaaatgtcagca
ctgcccaaagaacaggatgacggtgctttgcaagttcagaagagcttcttggatggaatt
tacaagactatccacaggccaccctacgagatggttaaaactgaagacttatcaagcaac
ttcctgtccctgcaggagatccagagtgcatactgtaaatttaagcaactgtttctgata
gataacagttcggaattttgggacacagacataaaatggttttctctcttagaaagcagc
agctggcttgatataatcagacgctgcctgaagaaagcaatcgagattacggaatgcctg
gaagcgcagaacgtgaacgtcctcctgttggaagagaatgcttctgatctctgctgcctc
ctctcctctctggtgcaagtgatgatggacgcccactgtcgaaccaggactggattccag
agcctcatccaaaaggaatgggtcatgggtggccactctttcttggaccgctgtaaccat
ctccaccagagtgacaaagaggaggtccctatcttcctgcttttcttggactgcgtctgg
cagctggtgcaccagtatcccccagcatttgagttcacagagacatacctgactgttttg
tcagatagcctgtatatacctatttttagcaccttcttcttcaattcacctcatcaaaaa
gatactaacatgggtagggaaaacctggatgcacaaagcaagcctttgactctgctcacc
gtgtgggactggtcagtacagtttgaacccaaagcacagacgttacttagaaaccctctc
tatgtggaaaagccaaaactggacagaggccagcagaaaggatcacgtttcaaacatcaa
cgacaactttctttgccacttacccagtctaagtcatctcccaaaagaggatttttcagg
gaagaaacagatcatttaatcaagaacctcctaggcaagagaattagtaaacttattaac
tcttccgatgacctccaggacagctcaagggagttctacgacagctggcatagcaagccc
acagactaccacggcctgttgttgcctcacattgaggggccggaaatcaaggtgtgggct
cagcgctatttacgttggattccagaagcccaaatcctgggtggtggcagagtggccacc
atgggcaaactcttagagatgatggaggaagtgcagagcttgcaggagaagatagaggca
agacaccacaggcaggaggctgtccatgcagaggcacccggcctgctcaggaactcagtc
cgcctgtcttccttgttcccctttgcactgctccagcgacattcggccaagcctgtctta
cccaccagtggctggaaagctttaggaggcgaagatgacctggccaaacgagaagatgag
tttgtggacctaggggacgtgtga

DBGET integrated database retrieval system