KEGG   Mus musculus (mouse): 268807
Entry
268807            CDS       T01002                                 

Symbol
Klhl38, 8230402K04Rik
Name
(RefSeq) kelch-like 38
  KO
K13959  kelch-like protein 38
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    268807 (Klhl38)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     268807 (Klhl38)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 BACK BTB Kelch_3 Kelch_2 Kelch_4 DUF1668
Other DBs
NCBI-GeneID: 268807
NCBI-ProteinID: NP_808423
MGI: 3045310
Ensembl: ENSMUSG00000022357
Vega: OTTMUSG00000028041
UniProt: Q8BSF5
Position
15; 15 D1
AA seq 581 aa
MDEELPDGVVFKDHSFSSDLLRQLNGLRQSKILTDVSICSGAWEVPCHRSVLASSSPYFK
AMFCSHFRESREAKVQMKGISSTTLEQVITYVYTGEVHISAANVLPLMEAAAMLQYPRVF
EACSSYLQSQLAPSNCLGLVRLAEILSCDSLKKKAKEVALTYFPEVAASADLKELCAMEL
RDYLGDDRLCGEEEKVFEALMAWVKHDLQARWRHMQELLQQVRLQYIHPAFFHHFIANDA
LLQSSPACQAILEMARKQIFSLYGPSAQDCKLLWRMPPRSSYQDFLLLLGGRKDNQQTTR
DVLLYSGQTGQWQSLAKLPIRLYKASAVTLHRSVYVLGGMTVSEGKSLISCGVYIFSLKL
NQWRVGEPMLAARYSHRSTTHRNFIFSIGGTGEGQELLASMERYDSIRDVWESMAGMPVA
VLHPAVAVKDQRLYLFGGEDIMQNPVRLIQVYHISRNTWYKMETRMIKNVCAPAVVLGEQ
IVIVGGYTRRILAYDPQSNKFVKCADMKDRRMHHGATVMGNKLYVTGGRRLTTDCNIEDS
ASFDCYDPETDTWTSQGQLPHKLFDHACLTLQCIPHMTSLS
NT seq 1746 nt   +upstreamnt  +downstreamnt
atggatgaggagttaccagatggggttgtcttcaaagaccacagcttctcctctgacttg
ttaagacagctcaatggcttaagacaaagcaagatcctgactgatgtgagcatctgctcc
ggggcctgggaggtcccttgtcaccgcagtgtgctggcctccagcagcccctacttcaag
gccatgttctgcagccacttccgggagagcagagaggccaaagtgcagatgaaaggcatc
agttccacaactctggagcaggtcattacgtatgtgtatacgggagaggttcatatctca
gctgccaacgtcctcccactgatggaggctgctgccatgctgcagtatccccgggtgttt
gaggcctgctcctcatacctccagagccagctggcccccagcaattgcctgggcctagtc
agactcgcagaaatcttaagctgtgacagccttaagaagaaagcgaaggaggtggccctg
acttacttcccagaggtggcagcatcagctgacctgaaggagctctgcgccatggagctg
agggactacctgggagatgacaggctctgtggtgaggaggaaaaggtgttcgaggccctc
atggcttgggtgaagcatgaccttcaagcccggtggaggcacatgcaggaactgctgcag
caggtccgcctgcagtacatccacccagccttcttccatcacttcattgccaatgacgcc
ctcctccagtcctcgcctgcttgccaggccatcctggagatggccaggaaacagatcttc
tctttgtatggtcccagtgcccaggattgtaaactcctatggcgcatgcccccaaggagc
tcctaccaagacttcctcctcctccttgggggacggaaggacaaccagcagaccaccagg
gatgtcttgctctacagtggacagactggccagtggcagagcctagccaagcttcccata
cggttgtacaaggcctcagctgtcaccttgcaccggagcgtctatgtgctcgggggcatg
actgtcagtgagggaaagagtctcattagctgtggtgtgtatatcttttctctgaaactc
aaccagtggagggtgggggagcccatgctggcagcccgctactcccacagaagcaccacc
cacaggaacttcatcttctccattgggggtactggagaagggcaggagcttctggcctcc
atggagaggtatgacagcatccgtgacgtctgggagagcatggctggcatgccagtggct
gtgctccaccctgccgtagcagtgaaggaccaaagactctatctttttgggggtgaggac
atcatgcagaaccctgtacgccttatccaggtttaccacatttccaggaacacctggtac
aaaatggagacaaggatgatcaagaatgtgtgtgcccctgcagtggtactgggggaacag
atcgtcattgtaggaggttacacaaggaggattcttgcttacgatcctcagtccaacaaa
tttgtcaagtgtgcggacatgaaagaccgaaggatgcaccatggggccacggtgatgggg
aacaagctgtacgtgacaggtggacggcggctgaccacagactgtaacatcgaggactca
gcttcctttgactgctacgacccagagacggacacttggacatcccagggacagctacct
cacaaactctttgaccatgcctgcctgaccctccagtgcataccccacatgaccagcctc
tcttga

DBGET integrated database retrieval system