KEGG   Mus musculus (house mouse): 268822
Entry
268822            CDS       T01002                                 
Symbol
Adck5, A230108P17
Name
(RefSeq) aarF domain containing kinase 5
  KO
K08869  aarF domain-containing kinase
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    268822 (Adck5)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  ABC1 family
   268822 (Adck5)
SSDB
Motif
Pfam: ABC1 APH Pkinase YrbL-PhoP_reg WaaY
Other DBs
NCBI-GeneID: 268822
NCBI-ProteinID: NP_766548
MGI: 2679274
Ensembl: ENSMUSG00000022550
UniProt: Q80V03 E9PUK2
Position
15:76460559..76480012
AA seq 582 aa
MWRPMRLCHFHSTLLQSRQKPWPCPAIFFRRNFKSPPARTSRARLLWRRALSATVVGTPF
LLGAYYFMAEASERRKLRLAVDGIGRFGRSVKIGLFISTDYWWCTNVVLRGVEENSPKYV
EIMSACHQRAADTLVAGAIRNGGLYVKLGQGLCSFNHLLPTEYIQTLRVLEDKALTRGFR
EVDELFLEDFQALPNELFQEFDYEPMAAASLAQVHRAKLHDGTDVAVKVQYIDLRDRFDG
DVQTLELLLRLVELMHPSFGFSWVLQDLKGTLVQELDFENEGRNAERCAQELKHFHYVVI
PRVHWDRSSKRVLTADFCNGCKVNDMEGIKSQGLAVQDVAKKLIQTFAEQIFHTGFIHSD
PHPGNVLVRKGPDGKAELVLLDHGLYQFLDEKDRSSLCQLWRAIILRDNAAMKKHAAALG
VQDYMLFSEVLMQRPVRLGQLWGSHLISREEAAYMQDMAREHFDGIMEVLKALPRPMLLV
LRNINTVRAINSNLGTPVDRYFLMAKSAVWGWSRLVGAAYQGIYGSSLLRHIKVLWEALK
FEMALRLEILAMRLTALMLRVLVRLGFAPKAEAEEVYQYLEM
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgtggcggccgatgcgactgtgtcacttccactctaccctgctgcagagcaggcagaag
ccctggccgtgccctgccatattcttcaggagaaacttcaagagcccaccagcaaggacc
tcaagagccaggctgctgtggaggcgggcactctctgccactgtggtggggacacccttc
ctacttggagcctactacttcatggcagaggcatcggagaggaggaagctgcgacttgca
gtcgatggtatcgggcgctttggcaggtctgtgaagattggtttgttcatctccacggac
tactggtggtgcacaaacgttgtccttcgaggagtggaagagaacagcccgaagtatgtg
gagatcatgtctgcctgtcaccagcgtgcggctgacaccctggtggctggagccatccgc
aacgggggcctctatgtgaaactgggccaagggctgtgctccttcaaccacctgctgccg
acagagtacatccagacgctgcgtgtgctggaggacaaggccctcactcggggcttccgg
gaggtggatgagttgttccttgaagacttccaggcactccctaatgaactcttccaggag
tttgactatgagccgatggctgctgcaagcctggctcaggtgcaccgtgccaagctacac
gatggcactgatgtagctgtaaaggtacagtacattgacctacgagaccgctttgacgga
gacgtgcagaccttggagctcctgctgcggctcgtggagctcatgcaccccagcttcggc
ttcagctgggtcctacaggacctgaaggggaccctggtccaggagctggacttcgagaat
gagggccgaaatgctgagcgctgtgctcaggagctaaagcacttccactatgttgttatc
cctcgggtgcactgggacaggtccagcaagcgggtgctgacagctgacttctgtaatggc
tgtaaggtgaatgacatggagggcatcaagagtcaggggctggcagtgcaggatgtagca
aagaagctgatccagacctttgctgaacagatcttccacactggcttcattcactctgac
ccccaccctggcaatgttctggtgcggaaaggtccagatggaaaggcagagctggtgctc
ctggaccacgggctctaccagttcctggacgagaaggaccgatcctccctctgccagctg
tggcgggccatcatcctgagggacaatgctgcaatgaagaaacatgcagctgcacttggg
gtccaagactacatgctcttctctgaggtgctcatgcagcgaccagtacgcctgggccaa
ctgtggggttcccacctgatcagccgggaggaggcggcctacatgcaggacatggcccgt
gaacactttgatggcataatggaagtgctcaaggcattgccacggcctatgctgctagtg
ctgcgaaacatcaacacagtgcgcgccatcaactcgaacctgggcacccctgtcgaccgc
tacttcctcatggccaagagtgctgtctggggttggagccgcctggtgggtgcagcgtac
caaggcatttacggcagcagcctcctgcgccacatcaaggtcctctgggaggcattaaag
tttgagatggccctgaggctggaaatcctagccatgcggctcaccgccctcatgctgcgt
gttctggtccgcctgggctttgcccccaaggctgaggccgaggaggtctatcagtacctg
gagatgtag

DBGET integrated database retrieval system