KEGG   Mus musculus (house mouse): 268902
Entry
268902            CDS       T01002                                 
Symbol
Robo2, 2600013A04Rik, 9430089E08Rik, D230004I22Rik, mKIAA1568
Name
(RefSeq) roundabout guidance receptor 2
  KO
K06754  roundabout, axon guidance receptor 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    268902 (Robo2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    268902 (Robo2)
   04515 Cell adhesion molecules [BR:mmu04515]
    268902 (Robo2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   268902 (Robo2)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  ROBO family
   268902 (Robo2)
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig fn3 V-set C2-set_2 Ig_5 Ig_6 Ig_4 Adeno_E3_CR1
Other DBs
NCBI-GeneID: 268902
NCBI-ProteinID: NP_001345419
MGI: 1890110
Ensembl: ENSMUSG00000052516
Position
16:complement(73688864..75244331)
AA seq 1527 aa
MARRQESICGRPWTWTPGLLMLIILGIHQGSGQGQGSRLRQEDFPPRIVEHPSDVIVSKG
EPTTLNCKAEGRPTPTIEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDE
GSYVCVARNYLGEAVSRNASLEVALLRDDFRQNPTDVVVAAGEPAILECQPPRGHPEPTI
YWKKDKVRIDDKEERISIRGGKLMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERP
TFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDDADLPRGRYDIKDDYTLRIKKAMS
TDEGTYVCIAENRVGKVEASATLTVRVRPVAPPQFVVRPRDQIVAQGRTVTFPCETKGNP
QPAVFWQKEGSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSIL
AKAQLEVTDVLTDRPPPIILQGPINQTLAVDGTALLKCKATGEPLPVISWLKEGFTFLGR
DPRATIQDQGTLQIKNLRISDTGTYTCVATSSSGETSWSAVLDVTESGATISKNYDMNDL
PGPPSKPQVTDVSKNSVTLSWQPGTPGVLPASAYIIEAFSQSVSNSWQTVANHVKTTLYT
VRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQDISPPAQGVDHRQVQKELGDVVVRL
HNPVVLTPTTVQVTWTVDRQPQFIQGYRVMYRQTSGLQASTVWQNLDAKVPTERSAVLVN
LKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEEAPSAPPQSVTVLTVGSHNSTSISVSWD
PPPADHQNGIIQEYKIWCLGNETRFHINKTVDAAIRSVVIGGLFPGIQYRVEVAASTSAG
VGVKSEPQPIIIGGRNEVVITENNNSITEQITDVVKQPAFIAGIGGACWVILMGFSIWLY
WRRKKRKGLSNYAVTFQRGDGGLMSNGSRPGLLNAGDPNYPWLADSWPATSLPVNNSNSG
PNEIGNFGRGDVLPPVPGQGDKTATMLSDGAIYSSIDFTTKTTYNSSSQITQATPYATTQ
ILHSNSIHELAVDLPDPQWKSSVQQKTDLMGFGYSLPDQNKGNNALLYIPDYRLAEGLSN
RMPHNQSQDFSTTSSHNSSERSGSLSGGKGGKKKKTKNSSKAQKNNGSTWANVPLPPPPV
QPLPGTELGHYAAEQENGYDSDSWCPPLPVQTYLHQGMEDELEEDEDRVPTPPVRGVASS
PAISFGQQSTATLTPSPREEMQPMLQAHLDELTRAYQFDIAKQTWHIQSNTPPPQPPAPP
LGYVSGALISDLETDVPDEDADDEEEPLEIPRPLRALDQTPGSSMDNLDSSVTGKAFSSS
QRQRPTSPFSTDSNTSAAQNQSQRPRPTKKHKGGRMDPQPVLPHRREGMPDDLPPPPDPP
PGQGLRQQIGLSQHSGNVENSTERKGSSLERQQAANLEDTKSSLDCPAKTVLEWQRQTQD
WINSTERQEETRKAPHKQGVGSEESLVPYSKPSFPSPGGHSSSGTSSSKGSTGPRKADVL
RGSHQRNANDLLDIGYVGSNSQGQFTE
NT seq 4584 nt   +upstreamnt  +downstreamnt
atggccagaagacaagaaagtatctgtggaaggccgtggacgtggacgccaggactactg
atgctgatcatccttggcattcatcaggggagtgggcaaggtcaaggatctcgtcttcgt
caagaagactttccccccaggatcgtagaacacccttctgatgtcatcgtctccaaggga
gagcccaccactctgaactgtaaagcagagggccgacccacccccaccattgaatggtac
aaggatggtgagagggtggagacagacaaggatgatcccaggtcccacagaatgcttctg
cccagcggatctttattctttttgcgaattgttcatgggcgcagaagtaaaccggacgaa
gggagttacgtttgtgttgcaaggaactatcttggtgaagcagtgagtcgaaatgcatct
ctggaagtggcattattgcgagatgacttccggcaaaaccccacagatgtggtagtcgca
gctggagagcctgcaatcttggagtgccagccaccacggggacacccagaaccaaccatc
tactggaaaaaggacaaagtccgaattgatgacaaggaagagagaataagtatccgtggt
gggaagctgatgatctctaatactaggaaaagcgatgctggcatgtacacctgtgtggga
accaatatggtgggagaaagggacagcgaccctgcagagctcactgtctttgaacgaccc
acatttctcaggaggccaattaaccaggtggtgctagaggaagaagctgtagaattccgt
tgtcaggtccaaggagatccccagccaacggtgaggtggaaaaaagatgatgcagacttg
ccgagaggaaggtatgatatcaaagatgactacacgctgagaattaaaaaggccatgagt
actgatgaaggtacctatgtgtgtattgctgagaatcgggtgggaaaagtggaagcctct
gctaccctcactgtccgagttcgccctgttgctcctccacagtttgtggttaggccaaga
gatcagatcgttgctcaaggccgaacagtgacattcccctgtgaaactaaaggaaaccca
cagccagctgttttttggcagaaagaaggcagccagaacctacttttcccgaatcaacct
cagcagcccaacagccgatgttcagtgtcgcccacgggggacctcaccatcaccaacatc
cagcgttcagatgcgggttactacatctgccaggccctaaccgtggcaggaagcatttta
gctaaagcacagttggaagttactgacgttttgacagatagacctccacccataatcttg
caaggaccaataaaccaaacacttgcagtagacggtacagcattgttgaagtgtaaagcc
actggtgagcctctgcctgtaattagctggctaaaggagggctttacttttctggggaga
gatccaagagccacgatccaagaccaaggaacactgcagattaagaatttacggatatct
gatactggcacttatacttgtgtggctacaagttccagtggagagacttcctggagtgca
gtgctggatgtaacagaatctggagcaacaatcagtaaaaattatgatatgaatgacctc
ccgggaccaccatccaaacctcaggtcactgatgtttctaagaacagtgtcaccttatcc
tggcagccaggtacacctggcgttcttcctgcaagcgcgtatatcattgaggctttcagc
caatcggtgagcaatagctggcagacagtggcaaaccatgttaagacaactctgtataca
gtaagggggctgaggcccaacacaatctacttgtttatggtcagagcgatcaacccacaa
ggtctcagtgatccaagtcctatgtcggatcctgtacgcacacaagatatcagcccccca
gcacaaggagtggaccacagacaggtgcagaaggaattaggtgatgtcgttgttcgtctc
cataatccagttgtcctgacacctacaactgttcaagtcacatggacggtggaccgacaa
ccccagtttattcagggctacagagtgatgtaccgtcagacttcgggactacaagcctca
actgtgtggcagaatctagacgccaaagtcccgactgagaggagtgctgtccttgtgaat
ttgaaaaagggggtgacttatgaaattaaagtccggccgtattttaacgagttccaagga
atggacagtgaatcgaaaacagtccgaaccactgaggaagccccaagtgcccctccccag
tctgtcactgtgctgacagttggaagtcacaacagcacaagcatcagtgtttcctgggat
cctccaccagccgaccaccagaatggaattattcaggaatataagatctggtgtctggga
aacgaaacgcgattccatatcaataaaacggtggatgcagccattcgctctgtagtaata
ggtggcttgttccctggaattcagtaccgggtagaagtggcagctagcacaagtgcaggg
gttggagtaaaaagtgaaccacagccgataataattgggggacgtaacgaagttgtcatt
actgaaaacaataacagcatcactgagcaaatcacggatgtcgtgaagcaaccggcattt
atagctggcattggtggtgcctgctgggtaattctgatgggttttagcatctggttgtac
tggagaagaaagaagagaaagggactcagcaattatgctgtaacatttcaaagaggagat
ggaggactaatgagcaatgggagccgtccaggtcttctaaatgctggcgatcccaattac
ccatggcttgctgattcttggccagccacgagtttgccagtgaacaatagcaatagtggc
ccaaatgaaattggaaattttgggcgtggagatgtgctgcctccggtgccaggccaaggg
gataaaacagcgaccatgctctcggatggagccatttatagcagcattgacttcactacc
aaaaccacttacaacagttccagccaaataacacaggccaccccatatgccactacacaa
atcctgcattcaaacagcatccacgaactggcagttgatcttcctgatccacagtggaaa
agctcagttcaacagaagacagacctcatgggatttggttattcgctacctgatcagaac
aaggggaacaacgccttactttacatccctgactaccgattggctgagggattgtctaat
agaatgccacacaaccagtcacaggatttcagcaccaccagctctcacaacagctcagaa
aggagtggcagtctctcaggtgggaaaggtggaaaaaagaagaaaactaaaaattcttcg
aaagcgcagaaaaacaacggatccacttgggctaatgtccctctacctcctcctcccgtc
cagccccttcctggtacagagctgggccactatgctgcggaacaagaaaatggctatgac
agtgacagctggtgcccaccattaccggtgcaaacatacttgcatcagggtatggaagat
gagctggaagaagacgaagatcgggtcccaacacctcctgttcgcggcgtggcctcttca
ccagctatctcttttggacagcagtccactgccactcttactccatccccacgggaagag
atgcaacccatgctgcaagctcacttggatgagttgacaagggcctatcagtttgatata
gcaaaacaaacatggcacattcaaagcaataccccacctccacaacccccagctccgcca
ttaggttacgtgtccggagccttgatttctgatttggagacagatgttccagatgaggat
gctgatgatgaagaggaaccattagaaattcccaggcccctcagagcactagaccagaca
cctggatccagtatggacaatctagacagctctgtcacaggaaaagcctttagctcctct
caaaggcagcggcccaccagcccattttctacggacagtaacaccagtgctgcccagaat
caaagccagaggcctcggcccacgaaaaaacataagggaggacggatggacccacagcca
gtgttacctcatcggagggaagggatgccagatgatcttcccccaccaccagatccccca
ccaggtcagggtttaaggcagcagataggcctgagccaacactctggtaacgtggaaaac
tcaacagagagaaaaggaagctctctagagagacaacaagcagccaacttagaagacaca
aagagctcattggattgtccagctaaaactgttctagagtggcagcgtcaaacccaggac
tggataaactctacagaacgccaagaagaaactcggaaagccccacacaaacaaggggtt
ggatcagaggagtccctggtgccctacagcaagcccagcttcccgtctcctggcgggcac
agctcatcaggaacatcttcctctaaagggtccactggccctcggaaggctgacgtgctg
agaggcagccaccagaggaatgccaatgaccttctcgacattggatatgtgggctcaaat
agtcaaggacagtttacagagtaa

DBGET integrated database retrieval system