KEGG   Mus musculus (mouse): 26893
Entry
26893             CDS       T01002                                 

Gene name
Cops6, Sgn3, VIP/MOV34
Definition
(RefSeq) COP9 signalosome subunit 6
  KO
K12179  COP9 signalosome complex subunit 6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    26893 (Cops6)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   COP9 signalosome (CSN) complex
    26893 (Cops6)
SSDB
Motif
Pfam: MitMem_reg JAB
Other DBs
NCBI-GeneID: 26893
NCBI-ProteinID: NP_036132
MGI: 1349439
Ensembl: ENSMUSG00000019494
Vega: OTTMUSG00000022638
UniProt: O88545 Q3UIT2
Position
5; 5 G2
AA seq 324 aa
MAAAAAAGANGSGGSSGMEVDAAVPSVMASGVTGSVSVALHPLVILNISDHWIRMRSQEG
RPMQVIGALIGKQEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQVFKELEFLG
WYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEATMLF
AELTYTLATEEAERIGVDHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILEYVK
ASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMN
QFVNKFNVLYDRQGIGRRMRGLFF
NT seq 975 nt   +upstreamnt  +downstreamnt
atggcggcggcagctgcggcgggggcgaatgggagcggaggcagcagcggcatggaagtg
gatgcagcagtccccagcgtgatggcctccggagtgactgggagtgtttccgtcgctctt
catccccttgtcatccttaacatctcagaccattggatccgcatgcgctcccaggagggg
cggcctatgcaggtgattggggctctgatcgggaagcaggaggggcgaaatatcgaagtg
atgaactcctttgagctgctgtcccacaccgtggaagagaagattatcattgacaaagaa
tattattacaccaaggaggagcagtttaaacaggttttcaaggagctggagtttctgggt
tggtataccacaggggggccacctgacccctcagacatccacgtccataagcaggtgtgt
gagataattgagagtccgctctttctgaagttgaaccctatgaccaagcacacagatctt
cctgtcagcgtttttgagtctgtcatcgatataatcaatggagaggccacaatgctgttt
gctgagctcacttacactctggccactgaggaagctgaacggatcggtgtagaccacgtg
gcccggatgacagcaacaggcagtggggagaactccactgtggctgaacacctgatagct
cagcatagtgccatcaagatgctgcacagccgtgtgaagctcattttagaatatgtcaag
gcctctgaagcaggagaggttcccttcaaccatgagatcctgcgggaggcctatgcccta
tgtcactgtcttccagttctcagcactgacaagttcaagacagacttttatgatcaatgc
aatgacgtggggctcatggcctacctcggcaccatcaccaaaacgtgcaacacaatgaac
cagtttgtgaacaagttcaacgtcctctacgaccgacaaggcattggccggcgaatgcgg
ggactgtttttctga

DBGET integrated database retrieval system