KEGG   Mus musculus (mouse): 268930
Entry
268930            CDS       T01002                                 

Gene name
Pkmyt1, 6230424P17, AW209059, Myt1
Definition
(RefSeq) protein kinase, membrane associated tyrosine/threonine 1
  KO
K06633  membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    268930 (Pkmyt1)
   04114 Oocyte meiosis
    268930 (Pkmyt1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    268930 (Pkmyt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    268930 (Pkmyt1)
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    268930 (Pkmyt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     268930 (Pkmyt1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  WEE family
   268930 (Pkmyt1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     268930 (Pkmyt1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Kdo
Other DBs
NCBI-GeneID: 268930
NCBI-ProteinID: NP_075545
MGI: 2137630
Ensembl: ENSMUSG00000023908
UniProt: Q9ESG9
Position
17; 17 A3.3
AA seq 490 aa
MTMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPGGLSRSLPPRPPAKGCIPVSRLFPP
RTPGWHQPQPRRVSFLCETSEPLQSPGYDPSRPESFFQQNFQRLSRLGHGSYGEVFKVRS
KEDGRLYAVKRYMSPFRGPKDRTRKLAEVGGHEKVGQHPHCVRLERAWEEGGILYLQTEL
CGPSLQQHCEAWGASLPEAQVWGYLRDILLALDHLHSQGLVHLDVKPANIFLGPRGRCKL
GDFGLLVELGSAGAGEAQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVACNMELPHGG
EGWQQLRQGYLPPEFTAGLSSELRSVLAMMLEPDPQLRATAEALLALPMLRQPRPWNVLW
YMAAEALSRGWALWQALVTLLCWLWHGLVHPASWLQPPGPPATPPGSPPCSPLLDSTLSS
SWDNDSIGPSLSPETVLSRITRRTSTPRGRYIPRDALDLTDVDSEPPRGPCPTFEPRNLL
SLFEDSLDPA
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgaccatgcccaccgagggcaccccaccacccctaagtggtacccccatcccagttcca
gcttacttccgacacgcagagcctggtttctccctcaaaaggcctgggggcctcagtcgg
agcctcccacctcggccccctgccaagggctgcatccctgtcagccgtctattcccccct
cgcaccccaggctggcaccagccccagccccggagggtgtctttcctgtgtgagacctca
gagcccctgcagagtcctgggtatgacccgagccggcccgagtccttctttcagcagaac
ttccagaggctcagccgcctgggtcatggctcatatggagaagtcttcaaggtgcgctct
aaggaagatgggcgactctatgctgttaagcgctacatgtcgccattccgcggccccaaa
gaccgaactcgtaaactggctgaggtaggtggccatgagaaagtggggcagcatccacac
tgcgtgagactggagcgggcctgggaggagggtggcatcctatacctgcagacagaactc
tgcgggcccagcctgcagcaacactgtgaagcctggggggccagcctgccagaggcccag
gtctggggctacttgcgggacattcttctggctctggaccatctacatagtcaaggccta
gttcaccttgatgtcaagcctgccaacatcttcttgggcccccggggccgctgcaagctg
ggcgactttggactactggtggagctgggttcagccggtgctggcgaggcccaggaggga
gatcctcgctacatggccccagaactgctgcagggctcttatgggacagcagcagatgtg
ttcagtctgggtctcaccatcttggaagtggcctgtaacatggaactgccccatggtggg
gagggctggcagcagctgcgccagggatacttgccccctgagttcactgctggtctgtct
tctgagctgcgttctgtcctcgccatgatgctggagcctgacccccagcttcgagccaca
gctgaggccctgttggccttacccatgctgaggcagccacgtccctggaatgttctgtgg
tatatggctgcggaagccctaagtcgaggctgggccctgtggcaggccctggtcactctg
ctctgctggctctggcacgggctggtgcatcctgccagttggctgcagcctccaggccca
ccggccacaccacctggctctccaccttgcagccccctcctggacagcaccctctccagc
agctgggataatgacagcataggtccctcactctccccagagaccgtcctgtcccggatc
actagaagaacctctacccctcggggcaggtacatacctagggatgccctggacctaact
gatgtggactcagagcctccaagaggtccctgccccacctttgagccaaggaacctcctc
agcctgtttgaggactccctagacccagcctga

DBGET integrated database retrieval system