KEGG   Mus musculus (mouse): 268932Help
Entry
268932            CDS       T01002                                 

Gene name
Caskin1, 3300002N10Rik, C130061I24, C630036E02Rik, mKIAA1306
Definition
(RefSeq) CASK interacting protein 1
  KO
K21952  CASK-interacting protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    268932 (Caskin1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    268932 (Caskin1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Caskin-Pro-rich Ank_4 SAM_1 Caskin-tail Ank SAM_2 Ank_3 Caskin1-CID SH3_2 SH3_1 SH3_9 NCD1
Motif
Other DBs
NCBI-GeneID: 268932
NCBI-ProteinID: NP_082213
MGI: 2442952
Ensembl: ENSMUSG00000033597
UniProt: Q6P9K8
Position
17; 17 A3.3
AA seq 1431 aa AA seqDB search
MGKEQELVQAVKAEDVGTAQRLLQRPRPGKAKLLGSTKKINVNFQDPDGFSALHHAALNG
NTELISLLLEAQAAVDIKDNKGMRPLHYAAWQGRKEPMKLVLKAGSAVNVPSDEGHIPLH
LAAQHGHYDVSEMLLQHQSNPCMVDNSGKTPLDLACEFGRVGVVQLLLSSNMCAALLEPR
PGDTTDPNGTSPLHLAAKNGHIDIIRLLLQAGIDINRQTKSGTALHEAALCGKTEVVRLL
LDSGINAQVRNTYSQTALDIVHQFTTSQASKEIKQLLREASAALQVRATKDYCNNYDLTS
LNVKAGDIITVLEQHPDGRWKGCIHDNRTGNDRVGYFPSSLGEAIVKRAGSRTGSEPSPP
QGGGSLGPSAPPEEIWVLRKPFAGGDRSGSLSNVAGGRSTGGHALHAGSEGVKLLATVLS
QKSVSESSPGDSPVKPPEGSSGAARSQPPAAHAGQVYGEQPPKKLESASASASEGKSAEA
VSQWLATFQLQLYAPNFTSAGYDLPTISRMTPEDLTAIGVTKPGHRKKITAEISGLNIPD
WLPEHKPANLAVWLSMIGLAQYYKVLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLM
LAVRKLAELQKAEYSKYEGGPLRRKTPQSLEMMAIESPPPSEPAAAECQSPKMTTFQDSE
LSGELQAALSGPAEAGAAAVEKSSNHLPPTPRTTSRESSLSGRARHISSSQELLGDGPPG
PGSPMSRSQEYLLDEGMAPGTPPKEVRSSRHGHSVKRASVPPVPGKPRQVLPSGASHFTP
PQTPTKAQPGSPQALGGPHGPATAKVKPTPQLLPPTDRPMSPRSLPQSPTHRGFAYVLPQ
PVEGEVGPPAPGPAPPPVPAAVPTLCLPPETDVEPGRPKKRAHSLNRYAASDSEPERDEL
LVPAAAGPYATVQRRVGRSHSVRAPAGTDKNVNRSQSFAVRPRKKGPPPPPPKRSSSAMA
SANLADEPAPDVEAEDGRLGVRAQRRRASDLAGSVDTGSAGSVKSIAAMLELSSIGGGGR
AIRRPPEGHPTPRPASPEPGRVATVLASVKHKEAIGPDGEVVNRRRTLSGPVTGLLATAR
RGSGEPAEQSHFMEDGTARQRLRGPAKGEASAEGPPLARVEASATLKRRIRAKQSQQENV
KFILTESDTVKRRPKAKEPDTGPEPPPPLSVYQNGTATVRRRPTSEQAGPPELPPPPPPA
EPPPADLMQLPPLPLPDGNARKPVKPPVSPKPILSQPVSKIQGSPTPASKKVPLPGPGSP
EVKRAHGTPPPVSPKPPPPPTAPKPAKALAGLQSSSATPSPVPSPARQPPAALIKPASSP
PSQSASPVKPPSPGTPALHVPAKPPRAAASVVSGPPVASDCASPGDSARQKLEETSACLA
AALQAVEEKIRQEDGQGPRPSSIEEKSTGSILEDIGSMFDDLADQLDAMLE
NT seq 4296 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggagcaggagctggtgcaggcagtgaaggcggaggacgtggggaccgcgcag
aggctgctgcagaggccgcggccggggaaggccaagctcctgggctctaccaagaagatc
aatgtcaacttccaggacccggatggcttctcagccctgcaccatgccgccctgaatggc
aacacagaattgatctctctgctgctggaggctcaggctgctgtagacatcaaggacaac
aaaggtatgcggccgttgcactacgccgcctggcagggccggaaggagcccatgaagctg
gtgctgaaggcaggctcagcagtaaatgtcccatccgacgaaggccacatacccctgcat
ttggctgcccagcatggtcactacgatgtgtcagagatgctactgcagcatcagtccaac
ccctgtatggtagacaactctggaaagacacctctggacctggcctgtgagttcggccgc
gtaggggtggtccagctgctgctaagtagcaacatgtgtgcagccttgctggagccccga
ccaggggacaccaccgaccccaacggcaccagccccctgcacctggcagccaagaatggc
cacatcgacatcatcaggctccttcttcaggccggcatcgacattaaccgccagaccaag
tctggcacagctcttcatgaggccgcactctgtgggaaaacagaagtggttcggctactg
ttggatagtgggatcaatgcccaggtgaggaacacctacagccagacagcactggacatt
gtacaccaatttacaacgtcccaggccagcaaggagatcaagcaactgcttcgagaggcc
tcagcggctctgcaggtccgggcaacaaaggattactgtaacaactatgatctgaccagt
ctcaatgtgaaggctggggacattatcacggtacttgaacagcatccagatggccggtgg
aaaggctgtattcatgacaaccggacaggcaatgacagggtgggctacttcccatcttcc
ctgggggaggctattgtcaagcgagcaggttcccggacaggcagtgagccaagcccaccc
cagggaggtggctcactgggtccctctgcacccccggaggagatctgggtgctgaggaag
ccttttgcaggtggagatcgcagtggcagcttgagcaatgtggccgggggcaggagtact
gggggccatgccttgcatgcaggctctgaaggagttaagctcctggcaaccgtgctttcc
cagaagtcagtctctgagtccagcccaggagatagcccggtcaagcctccagagggctct
tcaggtgcggcccggtcccagcctccagcagcccatgctgggcaggtatatggggagcag
ccaccgaagaagctggaatcggcctcagcctcggcctctgagggcaagagtgctgaggcg
gtcagtcagtggcttgccacattccagctacagctctatgcccccaacttcaccagtgct
ggctatgacctgcccaccatcagtcgtatgacccctgaggacctcacagccattggcgtt
accaagccaggccaccgtaagaagattacggcagagatcagcggcctgaacatccctgac
tggctgcctgaacacaaacccgctaacctggctgtgtggctgtcaatgattggtctggcc
cagtattacaaggtgctggtggacaacggctatgagaacattgatttcatcaccgatatc
acctgggaggacctgcaggagatcggtatcaccaagctgggacaccaaaagaagctgatg
ctggcagtgaggaaactggcagagctgcaaaaggcagaatactccaagtatgagggggga
cccctgcgccgaaagacaccccaatcacttgaaatgatggctattgagtcaccgccccca
tctgagcctgctgcagcagagtgccagtctcccaagatgaccaccttccaggacagtgaa
ctcagtggagagctgcaagctgccctgtctggcccagctgaagcaggtgcagctgctgtt
gagaaatcctccaaccacctgccacccactccgaggacaacctctcgggagtccagcctg
agtggacgggctcggcacataagcagctctcaggagctgttgggcgatgggcctccaggg
cctggcagtcctatgtcacgaagtcaggaatacctgctggatgaggggatggctcctggc
accccacccaaggaggtgcggtccagccgccatggccacagcgtcaagagggccagtgtg
cccccggtgcccggcaagccacgacaggtccttccgtctggtgccagccacttcacaccc
ccacagacgcccaccaaagctcagccaggctcccctcaggcccttgggggacctcatggt
ccagccacagccaaggtgaagcccaccccacagctgctaccaccaacagaccggcccatg
tcaccccgttccttgcctcagtcacccacacaccgtggctttgcctatgtgctgcctcag
ccagttgagggcgaggtagggccacctgctcccggacctgcgcccccaccagtacccgca
gctgtacctactctatgcttgcccccagaaactgatgtagagcctgggaggcccaagaaa
cgtgcccacagcttgaatcgctatgcagcatccgacagtgagcctgagagggatgagctg
ctggtgccggctgccgctggaccctatgccacagtccagaggcgtgtgggtcggagccat
tcagtgagggctcctgctggcacggacaagaatgttaaccgcagtcagtcctttgctgtg
cggccacgtaagaaggggcccccaccacctccacccaaacgctccagctcggccatggcc
agtgccaacctagccgacgagccggctccagacgttgaggcagaggacggccggctaggg
gtccgggcgcaacgccgtcgggctagtgatctcgccggcagtgtggacacaggtagtgct
ggcagtgtgaagagcatcgcagccatgttggagctgtcttccattgggggtggagggcgg
gctattcgcaggccccccgaaggccaccccacaccccgtcccgccagtccagaaccgggc
cgagtagctaccgtgttggcctctgtgaagcacaaagaggccattgggcctgacggtgaa
gtggtgaaccggcgccgtacactcagtggcccagtcactgggcttttggccactgctcgc
cgggggtctggggaacctgcagagcagagtcattttatggaggatggcacagcccgacaa
cggcttcgaggtccagctaagggtgaggcaagtgcggagggtcctccccttgcccgggta
gaggccagtgccacgctcaagaggcgcatccgggccaagcagagccaacaagagaacgtc
aaattcatcctgacagagtctgacacagtgaagcgcaggcctaaggctaaggagcctgac
actggccctgagccacccccaccactgtctgtgtatcagaatggcacagccaccgttcgc
cgaaggccaacctcagagcaggctgggcctccagagctgccccctcctccccctcctgct
gagcccccacccgctgacctgatgcagctgcctccactgcccctgcctgatggcaatgca
cggaagcctgtgaagccacccgtctctcccaagcccattctgtctcagcctgtgtccaag
atccagggctcacctacacctgcctccaagaaggtgccactgccaggccctggcagccca
gaggtaaagcgtgctcatggcacgccaccgcccgtgtcacccaagccgcctccgccacct
acagcacccaagccagccaaggctttggcgggactacagtccagcagcgccaccccctcg
cctgtgccctctccagcgcgtcagccgccagcagcgctcatcaagccagctagttcgccg
ccctcgcagagcgccagccctgtcaagcccccttccccagggacacccgcgctgcacgta
cccgccaagccccctcgcgctgctgcttcagtggtctccggacccccagtagcttcagat
tgtgcttcacccggggacagcgctcggcagaagctggaagagactagcgcgtgtttggct
gcagcactgcaggcagtggaggagaagataaggcaggaagatggacaaggccctcgcccc
tcctccatcgaggagaagagcactggcagcatcctggaagacatcggcagcatgttcgac
gacctggccgaccagctggacgccatgctggagtga

DBGET integrated database retrieval system