KEGG   Mus musculus (mouse): 268934
Entry
268934            CDS       T01002                                 

Gene name
Grm4, Gprc, Gprc1d, mGlu, mGluR4
Definition
(RefSeq) glutamate receptor, metabotropic 4
  KO
K04607  metabotropic glutamate receptor 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04724  Glutamatergic synapse
mmu04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    268934 (Grm4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    268934 (Grm4)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    268934 (Grm4)
  09157 Sensory system
   04742 Taste transduction
    268934 (Grm4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    268934 (Grm4)
G protein-coupled receptors [BR:mmu04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   268934 (Grm4)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6 DUF3930 Haem_degrading
Other DBs
NCBI-GeneID: 268934
NCBI-ProteinID: NP_001013403
MGI: 1351341
Ensembl: ENSMUSG00000063239
Vega: OTTMUSG00000028925
UniProt: Q68EF4 A0A140T8R6
Position
17; 17 A3.3
AA seq 832 aa
MSGKGGWAWWWARLPLCLLLSLYGSWVPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKACGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTLASEGSYGESGVEAFIQ
KSRENGGVCIAQSVKIPREPKTGEFDKIIKRLLETSNARAIIIFANEDDIRRVLEAARRA
NQTGHFFWMGSDSWGSKSAPVLRLEEVAEGAVTILPKRTSVRGFDRYFSSRTLDNNRRNI
WFAEFWEDNFHCKLSRHALKKGSHIKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQY
QRRNGSAEYKVIGSWTDHLHLRIERMQWPGSGQQLPRSICSLPCQPGERKKTVKGMACCW
HCEPCTGYQYQVDRYTCKTCPYDMRPTENRTSCQPIPIVKLEWDSPWAVLPLFLAVVGIA
ATLFVVVTFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLG
LGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFVLISLQLLGICVWFVV
DPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPET
FNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKVTSEALPVEFSPPLLAHN
NT seq 2499 nt   +upstreamnt  +downstreamnt
atgtccgggaagggaggctgggcctggtggtgggcccggctgcccctctgcctactcctc
agcctttatggctcctgggtgccttcatccctaggaaagcccaagggtcacccccacatg
aactctatccgtatcgatggagacatcaccctgggaggcctgtttcccgtccacggtcgc
ggctccgagggcaaggcctgcggcgagttgaagaaggagaaaggtatccaccggctggag
gccatgctctttgccctggaccgcatcaacaacgacccggacctactgcccaacatcacg
ttgggcgcccgcattctggacacctgctcaagggatacccacgccctggagcagtccctg
acctttgtgcaggcgctcatcgagaaggacggcacggaggtccgctgcggcagcgggggc
ccacccatcatcaccaagcctgaacgagtggtgggtgtcatcggagcttcggggagctcc
gtctcgatcatggtggccaacatcctccgcctcttcaagatcccccagatcagctacgcc
tccacggctcccgacttgagtgataacagccgctatgacttcttctcccgggtcgtgccc
tcggacacataccaggcccaggccatggtggacatcgtccgggccctcaagtggaactat
gtgtccacgctggcctcagagggtagctacggcgagagcggcgtggaggcctttatccag
aagtcccgagagaacggaggcgtgtgcattgcccagtcggtgaagattccacgggaaccc
aagaccggggagtttgacaagatcatcaaacgccttctggaaacgtccaatgccagagcc
atcatcatctttgccaacgaggatgatatcaggagggtgctggaggcagcgcgcagggcc
aaccagaccggccacttcttttggatgggttctgatagctggggctccaagagcgccccc
gtgctgcgccttgaggaagtggctgaaggtgcagtcaccattcttcccaagaggacgtct
gtgcgagggtttgaccgatacttctccagccgcacgcttgacaacaacaggcgcaacatc
tggtttgctgagttctgggaggacaacttccattgcaagttgagccgccacgcgctcaag
aagggaagccacatcaagaagtgcaccaaccgagagcgcatcgggcaggactcggcctac
gaacaggaggggaaggtgcagtttgtgatcgacgccgtgtacgccatgggccatgctctg
cacgccatgcatcgtgacctgtgtcccggccgcgtaggactctgccctcgaatggaccct
gtggatggcacccagctgcttaagtacatcagaaacgtcaacttctcaggcatcgccggg
aacccggtgaccttcaacgagaacggagacgcgccagggcgttatgacatctaccagtac
caacgtcgcaacggctcggctgagtacaaggtcatcggctcatggacagaccacttgcac
ctcagaatagagcggatgcagtggccagggagtggccagcagctgccacgctccatctgc
agcctgccctgccagccaggcgagcggaagaagacggtgaagggcatggcttgctgctgg
cactgcgagccctgcacggggtaccagtaccaggtggaccgctacacctgtaagacctgc
ccctatgacatgcggcccacggagaaccgcacgagctgccagcccatacccattgtcaag
ttggagtgggactcaccctgggctgtgctgcccctcttcctggctgtggtgggcattgct
gccacgctgttcgtggtggtcacttttgtgcgctacaacgacactccgatcgtcaaggcc
tcgggccgggagctgagctacgtcctgctggcgggcatctttctctgctatgccaccacc
ttcctcatgatcgcagagcctgacctggggacctgttcactccgccgcatcttcctgggg
cttggcatgagcatcagctacgcggccctgctgaccaagaccaaccgcatctaccgcatc
tttgagcagggcaagcggtcggtcagcgccccacggttcatcagccccgcctcgcagctg
gccatcaccttcgtcctcatctcgctgcagttgcttggcatctgcgtgtggttcgtggtg
gacccctcccactcggtggtggacttccaggaccagcggacacttgacccccgcttcgcc
cggggtgtgctcaagtgtgacatctcggacctgtcgctcatctgcctcctgggctacagc
atgctgctgatggtcacgtgtactgtgtatgccatcaagactcgaggcgtgcctgagacc
ttcaatgaggccaagcccatcggcttcaccatgtacaccacctgcatcgtctggctggcc
ttcatccccatcttttttggcacctcgcagtcggctgacaaggtaacctctgaggccctg
cccgtggaattcagcccgccattgctggcacataattaa

DBGET integrated database retrieval system