KEGG   Mus musculus (mouse): 268936Help
Entry
268936            CDS       T01002                                 

Gene name
Brpf3, AI413466, AW493400, mKIAA1286
Definition
(RefSeq) bromodomain and PHD finger containing, 3
  KO
K11350  bromodomain and PHD finger-containing protein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    268936 (Brpf3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    MOZ/MORF complex
     268936 (Brpf3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EPL1 zf-HC5HC2H_2 zf-HC5HC2H Bromodomain PWWP PHD_2 PHD FYVE_2 ATP12 Elf-1_N DNA_topoisoIV
Motif
Other DBs
NCBI-GeneID: 268936
NCBI-ProteinID: NP_001074784
MGI: 2146836
Ensembl: ENSMUSG00000063952
Vega: OTTMUSG00000017315
UniProt: B2KF05
Position
17; 17 A3.3
AA seq 1204 aa AA seqDB search
MRKPRRKSRQNAEGRRSPSPYSLKCSPTRETLTYAQAQRIVEVDIDGRLHRISIYDPLKI
ITEDELTAQDITECNSNKENSEQPQFPAKSKKPSSKGKRKESCSKHASGTSFHLPQPSFR
VVDTGSQPEAPPLPAAYYRYIEKPPEDLDAEVEYDMDEEDIAWLDMVNEKRRADGHSSVS
ADTFELLVDRLEKESYLESRSSGAQQSLIDEDAFCCVCLDDECHNSNVILFCDICNLAVH
QECYGVPYIPEGQWLCRCCLQSPSRPVDCVLCPNKGGAFKQTSDGHWAHVVCAIWIPEVC
FANTVFLEPIEGIDNIPPARWKLTCYICKQKGLGAAIQCHKVNCYTAFHVTCAQRAGLFM
KIEPMRETSLNGTTFTVRKTAYCEAHSPSVAVARRKGDSPRSLSEVGDEDGPKEGGGEEE
QEEAEEEGQEGQGGVGSPLKGVSKKGKMSLKQKIKKEPEEAGREAPSITLPMVTVPQIPS
YRLNKICSGLSFQRKTQFMQRLHNYWLLKRQARNGVPLIRRLHSHLQSQRNAEQREQDEK
TSAVKEELKYWQKLRHDLERARLLIELIRKREKLKREQVKVQQAAMELELMPFTVLLRTT
LDLLQEKDSAHIFAEPVSLSEVPDYLEFISKPMDFSTMRRKLESHLYHTLEEFEEDFNLI
VTNCMKYNAKDTIFHRAAVRLRDLGGAILRHARRQAENIGYDPERGTHLPESPRLEDFYR
FSWEDVDNILIPENRAHLSPEAQLKELLEKLDLVSTMRSSGARTRRVRMLRREINALRQK
LAQPPPPQLLSLNKTVPNGELPAGSRGDTAVLEQAQQEEPEEEGDRDDSKLPAPPTLEPT
GPAPSLSEQESPPDPPTLKPISDSKPSSRFLKSRKVEDEELLEKSALQLGSEPLQCLLSD
NGIDRLSLTNPDSHPDTPLGTVGRRTSVLFKKAKNGVKLQRGPDGTLENGEDHGPEDDPA
SPASTEDEHYSRKRPRSRSCSDSEGERSPQQEEETGVTNGFGKHTESGSDSECSLGLSGG
LAFEAGSGLTPPKRSRGKPALSRVPFLEGVNGDSDHSGSGRSLLMPFEDHGDLEPLELVW
AKCRGYPSYPALIIDPKMPREGLLHNGVPIPVPPLDVLKLGEQKQAEAGERLFLVLFFDN
KRTWQWLPRDKVLPLGVEDTVDKLKMLEGRKTSIRKSVQVAYDRAMIHLSRVRGSHAFVT
SSYL
NT seq 3615 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcctcgccgaaagtcacggcagaatgccgagggccggagatccccatcccca
tacagtcttaagtgctcacccacacgggagaccctgacttacgcccaagcccagaggatt
gttgaggtcgacatcgatggccgcctacatcggatcagcatttatgacccacttaagatc
atcactgaagatgagctgactgctcaggatattaccgaatgcaatagcaacaaggaaaac
agtgagcagccccaattccctgccaagtccaagaaaccctcatcaaagggcaagaggaag
gagtcctgttccaagcatgcgtccggtacctccttccacctcccccagcccagctttcgt
gtggtggatacggggagccagccagaagcgcccccattgcctgctgcttactaccgatac
attgagaagcctccggaagacctggatgcggaggtagagtacgacatggacgaggaggac
attgcctggctagacatggtcaacgagaagcgccgagcagacggccacagctcggtgtcg
gcagacaccttcgagctgctggtggaccggcttgagaaggaatcctacctggagagccgc
agcagtggggcccagcagtccctaatcgacgaagacgccttctgttgcgtgtgcctggac
gatgagtgccacaatagcaatgtcatcctgttctgcgacatctgcaacttagctgtgcac
caggagtgctacggcgttccctatatcccagagggccagtggctatgtcgctgctgcctg
cagtctccctctcgtcccgtggattgcgtcctgtgccccaataaaggtggggccttcaaa
cagaccagtgatggccactgggcccacgtagtctgcgccatctggatccctgaggtctgc
ttcgctaataccgtgttcctggagcctattgagggcatcgacaacattccacccgcccgc
tggaagctaacctgctatatctgcaagcagaaagggctgggcgcggccattcagtgccat
aaagtgaactgctacaccgctttccacgtgacatgcgcgcagcgggctgggctcttcatg
aagattgaacccatgagagaaaccagcctcaacggcaccacctttactgttcgcaagact
gcgtattgtgaggcccactctccaagtgtggccgttgccaggagaaagggcgactcccca
aggagcctcagtgaagtcggggatgaggatgggccgaaagagggtggaggggaggaggag
caggaagaagctgaggaggagggccaggaaggccaaggtggggtgggcagccccctcaag
ggcgtgtccaagaagggtaagatgagtttgaagcagaagatcaagaaggagccagaggaa
gctggccgagaggcaccctccatcactctccccatggtcactgtcccacagataccctct
tacaggttgaacaagatctgtagtggtctctcctttcagaggaagacccagttcatgcag
cggcttcacaactactggctgctgaagcggcaggctcggaacggtgtccccctcatcagg
cgcctgcactcccacttacagtcccagagaaatgctgagcagcgggagcaggacgagaag
actagtgcagtgaaggaggagctcaaatactggcagaaacttcgccatgacctggagcga
gcgcggctgctgatcgagctcatccgcaaaagggagaagctcaagcgggagcaggtcaaa
gtacagcaggctgccatggagctggagctgatgccgtttacggtcctgttgaggacgact
ctggacctgctgcaggagaaagactctgcacacatctttgctgaacctgtcagcctgagt
gaggttccagattacctggaattcatatccaagccaatggatttttctactatgaggcgg
aagctggaatctcacctgtaccacaccttggaggagtttgaggaggactttaaccttata
gttaccaactgcatgaagtataatgctaaagacacaattttccaccgagcagctgtccgc
ctccgggacctgggaggggccatcctgcggcacgcccggcggcaggcagagaacatcggc
tatgatcctgagaggggcacccacttgcccgaatcacccagattggaagacttttaccga
ttctcctgggaggatgtggacaacatccttatcccagagaaccgggcccatctgtcccca
gaggcacagctgaaggaactgctggagaaactggatctggtgagcaccatgcggtccagc
ggggcccgcacccgtcgtgtccgcatgctgcgcagggagatcaatgcccttcggcaaaag
ctagcacagccaccgccaccacagctcctgtcactgaacaagactgtgcccaacggggag
ctgccagcaggatctcggggggatacagctgtcctggagcaggctcagcaggaggagcca
gaagaggaaggggacagagatgattcaaaattgcctgccccaccaaccctggagcctacc
gggcctgcgccttccttgtcagaacaggaatcccctccagatcccccaaccctgaaaccc
atcagcgacagcaaaccttcaagccggttcctaaagtcccggaaggtggaagatgaggag
ctcttagaaaaatcagccctgcaactggggagcgagcccttgcaatgcttgcttagtgac
aatggcattgacagactgtccctcacaaaccccgacagccatcctgacacccctctcggc
accgtgggccgccgaacctccgtcctcttcaagaaggccaagaatggagttaagctacag
aggggtcccgatgggacccttgagaatggcgaggaccatggcccagaggacgatcctgct
tctccagccagcacagaggatgaacactattcccggaagcggccaaggagccggagctgt
agtgacagtgaaggggagaggtcccctcagcaggaggaagagacaggcgtgactaacggc
tttggaaaacacacggaaagcgggtctgactcggaatgtagtttgggtctcagtggagga
ctggcgtttgaagctggcagtggcctgacgcctcccaaacgcagccgtgggaagccagcc
ctgtctcgtgtgcccttcctggaaggtgtgaatggagactctgaccacagtggctcaggc
agaagcctcctgatgccctttgaagaccacggagacctggagcccctggagctggtgtgg
gccaagtgccgaggctacccctcctaccctgccttgatcatcgatcccaagatgccccgg
gagggcctcctgcacaacggtgtccccatccctgtccctccactggacgtgctgaagctg
ggcgagcagaagcaggcagaggctggagagaggctctttcttgtcctcttctttgacaac
aagaggacctggcagtggcttccaagggacaaagtcctgcccctgggtgtggaggacact
gtggacaagctcaagatgctagaaggccgcaagaccagcatccggaagtcagtacaagtg
gcctatgaccgcgccatgatccacctgagccgagtgcgtggctcccatgcctttgtcact
tccagctacctgtga

DBGET integrated database retrieval system