KEGG   Mus musculus (house mouse): 26894
Entry
26894             CDS       T01002                                 
Symbol
Cops7a, D6Ertd35e, SGN7a
Name
(RefSeq) COP9 signalosome subunit 7A
  KO
K12180  COP9 signalosome complex subunit 7
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    26894 (Cops7a)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   COP9 signalosome (CSN) complex
    26894 (Cops7a)
SSDB
Motif
Pfam: CSN7a_helixI PCI
Other DBs
NCBI-GeneID: 26894
NCBI-ProteinID: NP_036133
MGI: 1349400
Ensembl: ENSMUSG00000030127
UniProt: Q9CZ04
Position
6:complement(124935408..124974866)
AA seq 275 aa
MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDF
ASTFRLLTVFAYGTYADYLAEARNLPPLTDAQKNKLRHLSVVTLAAKVKCIPYAVLLEAL
ALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIAQTLQEWCVG
CEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLT
ELREPASGTNQRQPSKKASKGKGLRGSAKIWSKSN
NT seq 828 nt   +upstreamnt  +downstreamnt
atgagtgcggaggtgaaggtgacagggcagaaccaagagcagtttctgctccttgccaag
tcggctaagggggcggcactggccacactcatccaccaggtgctggaggcccctggtgtc
tacgtgtttggggaactgctggatatgcctaatgttagagagctggcagaaagcgacttt
gcctccaccttccggctgctcacagtgtttgcctatgggacctatgcggactacttagct
gaagccaggaatctccccccactgactgacgcacagaagaataagcttcgacatctgtca
gttgtcactctggctgccaaagtcaagtgtatcccatatgcagtgttgctggaggccctt
gcccttcgaaacgtgcgccagctggaagaccttgtgatcgaggctgtgtatgctgatgtc
cttcgtggctctctggaccagcgcaatcagcggctagaggttgattacagcatcgggcgg
gacatccagcgccaggacctcagtgccatcgcccagaccctgcaagagtggtgcgtgggc
tgtgaggttgtgttgtcgggcatcgaagagcaggtcagccgtgccaaccagcacaaggag
cagcagctgggcctgaagcagcagatcgaaagtgaggttgccaaccttaagaaaaccatt
aaagttacgacagcagctgctgctgcagccacctcccaggatcctgagcaacacctgaca
gagctgagagaaccagcttctggcaccaaccagcgccagcccagcaagaaagcctccaag
ggcaagggactccgagggagcgccaagatttggtccaagtcgaactga

DBGET integrated database retrieval system