KEGG   Mus musculus (mouse): 26895Help
Entry
26895             CDS       T01002                                 

Gene name
Cops7b, D1Wsu66e, E130114M23
Definition
(RefSeq) COP9 signalosome subunit 7B
  KO
K12180  COP9 signalosome complex subunit 7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    26895 (Cops7b)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   COP9 signalosome (CSN) complex
    26895 (Cops7b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CSN7a_helixI PCI DUF4464
Motif
Other DBs
NCBI-GeneID: 26895
NCBI-ProteinID: NP_766562
MGI: 1349388
Ensembl: ENSMUSG00000026240
Vega: OTTMUSG00000027307
UniProt: Q8BV13
Position
1 C5; 1 43.97 cM
AA seq 264 aa AA seqDB search
MAGEQKPSSNLLEQFILLAKGTSGSALTTLISQVLEAPGVYVFGELLELANVQELAEGAN
AAYLQLLNLFAYGTYPDYIANKESLPELSVAQQNKLKHLTIVSLASRMKCIPYSVLLKDL
EMRNLRELEDLIIEAVYTDIIQGKLDQRNQLLEVDFCIGRDIRKKDINNIVKTLHEWCDG
CEAVLLGIEQQVLRANQYKENHHRTQQQVEAEVSNIKKTLKATASSSAQEMEQQLAEREC
PPHTEQRQPTKKMSKVKGLVSSRH
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtgaacagaaaccctcaagtaacctcttggagcagttcattttattagccaaa
ggtaccagtggctcagccctcaccactctcataagccaggtgctagaggctcctggagtt
tatgtttttggagaactgctggagttggccaatgttcaggagcttgcagaaggagctaat
gctgcgtatttgcagttgctgaacctgtttgcctatggtacatacccggattacatagcc
aacaaggagagcctgccagaactgagtgtggctcagcagaacaagctgaagcatcttacc
atcgtgagcttggcatcaagaatgaagtgtatcccctactctgtgctgctgaaagacctg
gagatgaggaatctcagggaactagaagaccttatcattgaggctgtctacactgacatc
atccagggcaaactggaccagcgaaatcagctcctggaagtggatttctgcattggccgt
gacatccggaagaaagatatcaataacattgtcaagaccttgcatgagtggtgtgacggc
tgtgaggcagttctcttgggcattgagcagcaggttctgagagccaaccagtacaaagag
aaccaccaccggactcagcagcaggtggaagccgaggttagcaacattaagaagacactc
aaagcaacagcatcctcctcagctcaggaaatggagcagcagctggctgaacgggagtgt
cccccccatactgagcagaggcaacccactaagaagatgtccaaagtgaaaggtctggtc
tccagccgccactag

DBGET integrated database retrieval system