KEGG   Mus musculus (mouse): 26897Help
Entry
26897             CDS       T01002                                 

Gene name
Acot1, ACH2, CTE-1, CTE-I, Cte1, D12Ucla1
Definition
(RefSeq) acyl-CoA thioesterase 1
  KO
K01068  acyl-coenzyme A thioesterase 1/2/4 [EC:3.1.2.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00062  Fatty acid elongation
mmu01040  Biosynthesis of unsaturated fatty acids
mmu01100  Metabolic pathways
mmu04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    26897 (Acot1)
   01040 Biosynthesis of unsaturated fatty acids
    26897 (Acot1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    26897 (Acot1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    26897 (Acot1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     26897 (Acot1)
Lipid biosynthesis proteins [BR:mmu01004]
 Fatty acid synthase
  Component type
   26897 (Acot1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAAT_C Bile_Hydr_Trans DLH Peptidase_S9 FSH1 AXE1
Motif
Other DBs
NCBI-GeneID: 26897
NCBI-ProteinID: NP_036136
MGI: 1349396
Ensembl: ENSMUSG00000072949
UniProt: O55137
Position
12 D1; 12 39.0 cM
AA seq 419 aa AA seqDB search
MEATLNLEPSGRSCWDEPLSIAVRGLAPEQPVTLRSVLRDEKGALFRAHARYRADSHGEL
DLARTPALGGSFSGLEPMGLLWAMEPDRPFWRLVKRDVQTPFVVELEVLDGHEPDGGQRL
AHAVHERHFLAPGVRRVPVREGRVRATLFLPPEPGPFPGIIDLFGVGGGLLEYRASLLAG
KGFAVMALAYYNYDDLPKNMETMHMEYFEEAVNYLRSHPEVKGPGIGLLGISKGGELGLA
MASFLKGITAAVVINGSVAAVGNTISYKDETIPPVTILRNQVKMTKDGLKDVVDALQSPL
VDKKSFIPVERSDTTFLFLVGQDDHNWKSEFYADEISKRLQAHGKEKPQIICYPAAGHYI
EPPYFPLCSAGMHLLVGANITFGGEPKPHAMAQLDAWQQLQTFFHKQLGSECLHVSPKI
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgacgctgaaccttgagccctcgggccgcagctgctgggacgaaccgctgagc
atcgccgtgcgcggcctggccccggagcagcccgtcacgctgcgctctgtcctgcgcgac
gagaagggcgcgctcttccgagcccacgcgcgctaccgcgcggactcccacggcgagctg
gacctggcgcgcacgcccgcgctgggcggcagcttctcggggctcgagcccatggggctg
ctctgggccatggagcccgatcggcctttttggcgattggtcaagcgcgacgtgcagacg
cccttcgtggtggagctggaggtgctggacggacacgagcccgacggcgggcagcggctt
gcacatgcggtgcacgagcgtcacttcttggctccgggggtgcggcgcgtgcccgtacga
gagggccgggtgcgcgccacgctcttcctgcccccagaacctggaccctttcctgggatc
atagacctttttggagttggaggtggccttctggagtatcgggcgagcctgctggctggg
aagggctttgccgtcatggctctggcttattacaactacgatgacctccccaagaacatg
gaaaccatgcacatggagtactttgaagaagccgtgaactacctgcgcagccaccccgag
gtaaaaggacctggaattgggctgcttgggatttccaaagggggtgaacttggccttgct
atggcctccttcctgaagggcatcacagctgctgtggtcatcaatggctccgtggctgct
gttgggaacaccatctcctacaaggatgagactataccccctgtgactatcctgagaaat
caggtcaaaatgaccaaggatggcctcaaggatgttgtagatgctttgcaaagccctctg
gtagacaagaagagcttcattcccgtggaaaggtctgacacgaccttcctgttcctcgta
ggtcaggacgaccacaactggaagagcgagttctatgctgatgagatctccaaacgcctg
caggcgcacgggaaggagaagccccagatcatctgctacccagcagcagggcattacatc
gagcccccttacttcccgctgtgcagcgctggcatgcacctcctggtgggtgccaacatc
acctttggaggggagcccaagcctcatgccatggcccagttggatgcatggcagcagctc
cagactttcttccacaaacagttgggtagtgagtgtttgcatgtgtctcctaaaatataa

DBGET integrated database retrieval system