KEGG   Mus musculus (mouse): 268973Help
Entry
268973            CDS       T01002                                 

Gene name
Nlrc4, 9530011P19Rik, CLAN, CLAN1, CLANA, CLANB, CLANC, CLAND, Card12, IPAF
Definition
(RefSeq) NLR family, CARD domain containing 4
  KO
K12805  NLR family CARD domain-containing protein 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05132  Salmonella infection
mmu05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    268973 (Nlrc4)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    268973 (Nlrc4)
   05134 Legionellosis
    268973 (Nlrc4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    268973 (Nlrc4)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   268973 (Nlrc4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NLRC4_HD NACHT CARD AAA_16 AAA_29
Motif
Other DBs
NCBI-GeneID: 268973
NCBI-ProteinID: NP_001028539
MGI: 3036243
Ensembl: ENSMUSG00000039193
UniProt: Q3UP24
Structure
PDB: 

Position
17; 17 E2
AA seq 1024 aa AA seqDB search
MNFIRNNRRALIQRMGLTVTKQICDDLFALNVLNNQEANVIYCEPLEQEAARKIIHMTMQ
KGSAACNLFLKSLENWDYFVYQDLTGQNLSYQVTEEDLNVLAQNLKDLYNSPAFLNFYPL
GEDIDIIFNLEKTFTEPIMWKKDHRHHRVEQLTLGSLLEALKSPCLIEGESGKGKSTLLQ
RIAMLWASGGCRALKGFRLVFFIHLRSARGGLFETLYDQLLNIPDFISKPTFKALLLKLH
KEVLFLLDGYNEFHPQNCPEIEALIKENHRFKNMVIVTTTTECLRHIRHVGALTAEVGDM
TEDSAKDLIEAVLVPDQVERLWAQIQESRCLRNLMKTPLFVVITCAIQMGRQEFQAHTQT
MLFQTFYDLLIQKNSHRYRGGASGDFARSLDYCGDLALEGVFAHKFDFEPEHGSSMNEDV
LVTIGLLCKYTAQRLKPTYKFFHKSFQEYTAGRRLSSLLTSKEPEEVSKGNSYLNKMVSI
SDITSLYGNLLLYTCGSSTEATRAVMRHLAMVYQHGSLQGLSVTKRPLWRQESIQSLRNT
TEQDVLKAINVNSFVECGINLFSESMSKSDLSQEFEAFFQGKSLYINSENIPDYLFDFFE
YLPNCASALDFVKLDFYERATESQDKAEENVPGVHTEGPSETYIPPRAVSLFFNWKQEFK
TLEVTLRDINKLNKQDIKYLGKIFSSATNLRLHIKRCAAMAGRLSSVLRTCKNMHTLMVE
ASPLTTDDEQYITSVTGLQNLSIHRLHTQQLPGGLIDSLGNLKNLERLILDDIRMNEEDA
KNLAEGLRSLKKMRLLHLTHLSDIGEGMDYIVKSLSEESCDLQEMKLVACCLTANSVKVL
AQNLHNLIKLSILDISENYLEKDGNEALQELIGRLGVLGELTTLMLPWCWDVHTSLPKLL
KQLEGTPGLAKLGLKNWRLRDEEIKSLGEFLEMNPLRDLQQLDLAGHCVSSDGWLYFMNV
FENLKQLVFFDFSTEEFLPDAALVRKLSQVLSKLTLLQEVKLTGWEFDDYDISAIKGTFK
LVTA
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgaactttataaggaacaacagacgagcccttattcaaaggatgggcttaacagttacc
aagcaaatctgcgatgacctctttgcattgaacgttctcaacaatcaagaagctaatgtc
atttactgtgagcccttggagcaggaagccgcccgaaagatcatccatatgactatgcag
aagggctcagcggcctgcaacctctttcttaagagtcttgaaaactgggactattttgtg
tatcaggacttaactggacaaaatctttcttatcaggtcacagaagaagacctgaatgtt
ttggcccagaatttaaaggacttgtacaacagccctgcttttctgaacttctaccccctg
ggtgaagatatcgacataatttttaatctggagaaaaccttcacagaacctatcatgtgg
aagaaggaccatcgtcatcaccgtgtggagcagctgactttgggcagcctgctcgaggct
ctgaagagcccctgcctgattgaaggcgagtctggcaaagggaagtccaccctgctgcag
agaatcgctatgctctgggcctctgggggctgcagggctctgaaggggttcagattagtc
ttcttcatccacctgagaagcgccagggggggactattcgaaacactgtacgatcagctc
ctgaacatacccgacttcatcagcaagccgaccttcaaggctctgctgctgaagctacac
aaggaggtcctctttcttctcgatggttacaatgaattccatccccagaactgcccagaa
attgaagccctgataaaggaaaaccatcgcttcaagaacatggtcattgtcaccaccacc
acggagtgcctgaggcatatcagacatgttggcgccctgactgcggaggtgggagatatg
accgaagacagtgccaaagatctcatcgaggcagtgctggtacctgatcaggttgaacgc
ctgtgggcccaaatccaggagtccaggtgcctgagaaatctgatgaagacccctctcttc
gtggtgatcacctgtgcaattcagatgggcagacaggaattccaagctcacacccaaacc
atgctgttccaaaccttctacgacctcctgatacagaaaaacagccacagatatagaggt
ggagcttcaggtgattttgccaggagcctagactactgtggagacctggccctagaaggt
gtgttcgcccacaaatttgattttgaacccgagcatgggtccagcatgaacgaggacgtc
ctggtgacaatagggctcctctgtaagtacacagctcagaggctgaagcccacgtataaa
ttctttcataaatcatttcaggagtacacggcaggtcggagactcagcagtttgctgacg
tccaaagagccagaggaggtgagcaaagggaacagctacttaaacaaaatggtttccatc
tctgacatcacatccctatatggcaatctgctcctctacacgtgtgggtcgtccacagaa
gcaaccagggcggtcatgaggcaccttgcaatggtttatcagcacggcagcctacaagga
ctttcagtcaccaagaggcctctctggaggcaggaatcaatccagagtctgagaaatacc
actgagcaagatgttctgaaagccatcaatgtaaattccttcgtagagtgtggcatcaat
ttgttctcagagagtatgtctaaatcagacctgagccaagaatttgaagctttctttcaa
ggtaaaagtttatacatcaactcagagaacatccctgactatttatttgacttctttgaa
tacttgcctaattgtgcaagcgcattggacttcgtgaagttggatttctatgaaagagct
acagagtcacaggacaaggcagaagagaatgtccctggagttcacacagaagggccctca
gaaacctacattccccccagggctgtgtctttgttcttcaactggaagcaggaattcaag
actctagaggtcacactccgagatattaacaagttgaataagcaagatatcaaatatctg
gggaagatattcagctctgccaccaacctccggctgcatatcaagagatgtgcagccatg
gctggaagactcagctcagtcctcagaacctgcaagaacatgcataccctcatggtggaa
gccagtcccctcaccacggatgacgaacagtacatcacatctgtgacaggcctccagaac
ttaagtattcaccgcttgcacactcaacagctgccaggtggtctgattgacagcttgggt
aatctgaagaacctcgagagactcatactggatgacatcaggatgaacgaggaagatgct
aaaaacctagccgaaggcctacgaagcctgaagaagatgcgtttactccatttgactcat
ttgtctgacattggggaggggatggactacatagtcaagtctctctcagaagaatcctgt
gatctccaagagatgaagttggtggcctgctgtctgactgcaaactctgtgaaagttcta
gcacagaatcttcacaatttgatcaagctgagcattcttgatatatcagaaaattacctg
gaaaaggatgggaatgaagctctacaggaactgatcggcaggcttggcgttctgggagag
ctcactacattgatgctgccttggtgctgggatgtgcacaccagcctgcccaagctgttg
aagcagttggaggggaccccaggacttgccaaacttggattgaaaaactggagactcaga
gacgaagagattaaaagtttaggtgaatttctggagatgaatcctctgagagacttgcag
cagttggatttagcggggcactgtgtgagcagtgacggatggctttacttcatgaatgtg
tttgagaatctgaagcagttagtgttttttgactttagcactgaggagttcttaccggat
gcagcactggtgaggaaacttagtcaagtgttatccaagttaactcttctgcaagaggta
aagctcacgggctgggagtttgatgactatgatattagcgctattaaaggcacctttaaa
ctagtgactgcttaa

DBGET integrated database retrieval system