KEGG   Mus musculus (mouse): 26898Help
Entry
26898             CDS       T01002                                 

Gene name
Ctsj, CATP, CatRLP, Ctsp
Definition
(RefSeq) cathepsin J
  KO
K09599  cathepsin P [EC:3.4.22.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    26898 (Ctsj)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    26898 (Ctsj)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     26898 (Ctsj)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C1: papain family
   26898 (Ctsj)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 26898
NCBI-ProteinID: NP_036137
MGI: 1349426
Ensembl: ENSMUSG00000055298
UniProt: Q9R014 A0A0R4J0V8
Position
13 B2; 13 32.62 cM
AA seq 333 aa AA seqDB search
MTPTVLLLILCFGVASGAQAHDPKLDAEWKDWKTKYAKSYSPEEALRRAVWEENMRMIKL
HNKENSLGKNNFTMKMNKFGDQTSEEFRKSIDNIPIPAAMTDPHAQNHVSIGLPDYKDWR
EEGYVTPVRNQGKCGSCWAFAAAGAIEGQMFWKTGNLTPLSVQNLLDCSKTVGNKGCQSG
TAHQAFEYVLKNKGLEAEATYPYEGKDGPCRYRSENASANITDYVNLPPNELYLWVAVAS
IGPVSAAIDASHDSFRFYNGGIYYEPNCSSYFVNHAVLVVGYGSEGDVKDGNNYWLIKNS
WGEEWGMNGYMQIAKDHNNHCGIASLASYPNIF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgactcctactgtccttctgttaatcctgtgctttggagtggcctcaggtgcccaagca
catgatcccaaattggatgctgagtggaaagactggaagactaaatatgcaaaatcatac
agtccggaagaagcactgaggagagcagtatgggaagaaaacatgagaatgatcaaactg
cacaacaaggagaatagtctggggaagaataacttcaccatgaaaatgaataaatttggt
gaccagaccagtgaagaattcagaaaatcaatagacaatattccaattcctgctgccatg
acagacccacatgcccagaaccatgtatctattggtttacccgattataaggattggaga
gaggaaggctatgtgactcctgtacggaatcagggtaaatgtggctcttgttgggctttt
gctgcagctggtgccatagaaggtcagatgttctggaaaactggcaacctcacccctcta
agtgtgcagaacctattggactgttctaaaactgtaggaaacaaaggctgccaatcgggt
actgcacaccaagcattcgagtatgttttgaaaaataaaggtcttgaagctgaggcaacc
tatccatacgaaggaaaagacggaccctgcaggtaccgtagtgagaacgctagtgctaat
atcacagattatgtgaacctcccaccgaatgagctttacctatgggttgctgtagcatct
attgggcctgtctctgctgccattgatgcttctcatgactctttcaggttctacaatgga
ggtatttattatgagccaaattgcagcagttactttgtgaatcatgcagttctggtggtt
ggctatggatctgagggagatgtgaaagatggtaataactactggctgatcaagaacagc
tggggtgaagaatggggcatgaatggctacatgcagattgccaaagatcacaacaaccac
tgtggaattgcttcacttgccagctatcccaatatattttga

DBGET integrated database retrieval system