KEGG   Mus musculus (mouse): 26901Help
Entry
26901             CDS       T01002                                 

Gene name
Ss18l2, 1110020I04Rik, AI463209, Deb1
Definition
(RefSeq) SS18, nBAF chromatin remodeling complex subunit like 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: SSXT
Motif
Other DBs
NCBI-GeneID: 26901
NCBI-ProteinID: NP_081070
MGI: 1349474
Ensembl: ENSMUSG00000032526
Vega: OTTMUSG00000062655
UniProt: Q9D174
Position
9; 9 F4
AA seq 77 aa AA seqDB search
MSVIFAPDWLRGKAKVNQETIQRLLEENDQLIRCIVEYQNKGRANECVQYQHVLHRNLIY
LATIADANTSSLTKAVE
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcatcttcgctcctgactggctacgcggcaaagccaaggtcaatcaagagaca
atccagcggctcctggaggagaatgaccagctgatccgctgtatcgtggagtatcagaat
aagggccgagcgaacgagtgcgtccagtatcagcatgtgttacatagaaatctcatttat
ttagctaccatcgcagacgccaacacaagcagtctcacaaaggcagtggagtag

DBGET integrated database retrieval system