KEGG   Mus musculus (mouse): 26904
Entry
26904             CDS       T01002                                 

Gene name
Sh2d1b1, EAT-, EAT-2, EAT-2A, Eat, Eat2, Eat2a, Sh2d1, Sh2d1b
Definition
(RefSeq) SH2 domain containing 1B1
  KO
K07989  SH2 domain-containing protein 1B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    26904 (Sh2d1b1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    26904 (Sh2d1b1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   26904 (Sh2d1b1)
SSDB
Motif
Pfam: SH2
Other DBs
NCBI-GeneID: 26904
NCBI-ProteinID: NP_036139
MGI: 1349420
Ensembl: ENSMUSG00000102418
Vega: OTTMUSG00000049940
UniProt: Q149T1
Structure
PDB: 
1I3Z

Position
1; 1 H3
AA seq 132 aa
MDLPYYHGCLTKRECEALLLKGGVDGNFLIRDSESVPGALCLCVSFKKLVYSYRIFREKH
GYYRIETNAHTPRTIFPNLQELVSKYGKPGQGLVVHLSNPIMRNNLCQRGRRMELELNVY
ENTDKEYVDVLP
NT seq 399 nt   +upstreamnt  +downstreamnt
atggatctgccttactaccatggctgcctgaccaagcgagagtgtgaagccctgctcctc
aagggaggtgtggatggcaactttctgataagagacagcgagtctgtgccaggagccctg
tgcctctgtgtctcgtttaaaaagcttgtctacagctaccgaatcttcagagagaaacat
ggatattacaggatagagactaatgctcatactccaagaacgatctttccaaacctacag
gaattggtctccaaatatggaaaaccgggtcaaggattggtggttcacctttcaaaccca
ataatgagaaacaacctatgccaaagagggagaagaatggagttagagctgaatgtttat
gagaacactgataaggagtatgtggacgtcttgccttga

KEGG   Mus musculus (mouse): 545378
Entry
545378            CDS       T01002                                 

Gene name
Sh2d1b2, EAT-2B, Eat2, Eat2b, Er, Ert, Sh2d1, Sh2d1c
Definition
(RefSeq) SH2 domain containing 1B2
  KO
K07989  SH2 domain-containing protein 1B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    545378 (Sh2d1b2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    545378 (Sh2d1b2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   545378 (Sh2d1b2)
SSDB
Motif
Pfam: SH2
Other DBs
NCBI-GeneID: 545378
NCBI-ProteinID: NP_001028671
MGI: 3622649
Ensembl: ENSMUSG00000073494
Vega: OTTMUSG00000019331
UniProt: Q45HK4
Position
1; 1 H3
AA seq 132 aa
MDLPYYHGCLTKRECEALLLKGGVDGNFLIRDSESVPGALCLCVSFKKLVYNYRIFREKN
GYYRIETEPSTPKTIFPNLEELISKFKTPGQGMVVHLSNPIMRSGFCPGARRLNLEANVY
ENTDEEYVDVLP
NT seq 399 nt   +upstreamnt  +downstreamnt
atggatctgccttactaccatggctgcctgaccaagcgagagtgtgaagccctgctcctc
aagggaggtgtggatggcaactttctgataagagacagcgagtctgtgccaggagccctg
tgcctctgtgtctcgtttaaaaagcttgtctacaactaccgaatcttcagagagaaaaat
ggatattacaggatagagactgagcccagtactccaaaaacaatctttccaaacctagag
gaattaatctccaaatttaaaacgccaggtcaaggaatggtggttcatctttcaaaccca
ataatgagaagcggcttctgtccaggagcgagaagactgaacttagaggcgaatgtttac
gagaacactgatgaggagtatgtggacgtcttgccttga

DBGET integrated database retrieval system