KEGG   Mus musculus (house mouse): 269061
Entry
269061            CDS       T01002                                 
Symbol
Cpsf7, 5730453I16Rik, AL022757, C330017N18Rik
Name
(RefSeq) cleavage and polyadenylation specific factor 7
  KO
K14398  cleavage and polyadenylation specificity factor subunit 6/7
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu03250  Viral life cycle - HIV-1
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    269061 (Cpsf7)
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    269061 (Cpsf7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    269061 (Cpsf7)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Pre-mRNA cleavage factor Im (CFIm)
     269061 (Cpsf7)
SSDB
Motif
Pfam: RRM_1
Other DBs
NCBI-GeneID: 269061
NCBI-ProteinID: NP_758506
MGI: 1917826
Ensembl: ENSMUSG00000034820
UniProt: Q8BTV2
Position
19:10502594..10525099
AA seq 471 aa
MSEGVDLIDIYADEEFNQDSEFNNTDQIDLYDDVLTAASQPSDDRSSSTEPPPPVRQEPA
PKPNNKTPAILYTYSGLRSRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRA
NGQSKGYAEVVVASENSVHKLLELLPGKVLNGEKVDVRPATRQNLSQFEAQARKRECVRV
PRGGIPPRAHSRDSSDSADGRATPSENLVPSSARVDKPPSVLPYFNRPPSALPLMGLPPP
PIPPPPPLSSSFGVPPPPPGIHYQHLMPPPPRLPPHLAVPPPGAIPPALHLNPAFFPPPN
ATVGPPPDTYMKASTPYNHHGSRDSGPPPSTVSEAEFEEIMKRNRAISSSAISKAVSGAS
AGDYSDAIETLLTAIAVIKQSRVANDERCRVLISSLKDCLHGIEAKSYSVGASGSSSRKR
HRSRERSPSRSRESSRRHRDLLHNEDRHDDYFQERNREHERHRDRERDRHH
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgtcagaaggagtggatttgattgatatatacgctgatgaagagttcaatcaggactcg
gagttcaacaatacagatcagattgacctatatgatgatgtgttgacggctgcctcacag
ccctcagatgacagaagcagtagcacggaaccaccccctcctgttcgccaggagccagct
cccaaaccaaacaacaagacccctgcaattctgtatacatacagtggcctgcggagtcgg
cgagcagctgtctatgtaggcagcttctcctggtggaccacagaccagcagctgatccag
gttatccgctctataggagtctatgatgtggtggagttgaaatttgcagagaatcgtgca
aatggccagtctaaaggatatgctgaggtggtggtagcctctgaaaattctgtccacaaa
ctgctggaactcttaccaggaaaagttcttaatggagaaaaagtagatgtgaggccggcc
acccggcagaacttgtcacagtttgaggctcaggctcggaaacgtgagtgcgtccgagtc
ccaagagggggaatacctccacgggcccactcccgagactctagtgattctgctgatgga
cgggcaaccccctctgagaatcttgtaccctcatctgctcgtgtggataagccccccagc
gtgttgccctactttaaccgtcctccttcagcccttcccctaatgggtctgcccccaccc
ccaattccacccccaccacctctctcctcaagctttggtgtccctcctcctcctcctggt
atccactaccagcatctcatgccccctcctcctcgattacctcctcatctggctgtacct
cccccgggggccatcccaccagcccttcacctcaacccagccttcttccccccaccaaat
gctacagtggggcctccaccagatacttacatgaaggcctctacaccctataaccaccat
ggcagccgagattcaggccctccaccttctacagtgagtgaagctgaatttgaagagata
atgaagcgaaacagagcaatttccagcagtgccatttccaaagcagtgtctggagctagt
gcaggggattacagtgacgccattgagacactactcacagccattgcagttatcaaacag
tcccgagtcgccaatgatgagcgttgccgggtcctcatctcctctcttaaggactgtctt
catggcatagaggccaagtcatacagtgtgggtgccagtgggagctcttctaggaaaaga
catcggtccagggagaggtcacccagccggtcccgggagagtagcaggaggcaccgagac
ttgcttcataacgaagaccggcatgatgattatttccaagagaggaaccgggaacatgag
agacaccgggatagagaacgggaccggcaccactga

DBGET integrated database retrieval system