KEGG   Mus musculus (mouse): 26909
Entry
26909             CDS       T01002                                 

Gene name
Exo1, 5730442G03Rik, M, Msa
Definition
(RefSeq) exonuclease 1
  KO
K10746  exonuclease 1 [EC:3.1.-.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    26909 (Exo1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    26909 (Exo1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    26909 (Exo1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     26909 (Exo1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    26909 (Exo1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     26909 (Exo1)
SSDB
Motif
Pfam: XPG_I XPG_N XPG_I_2
Other DBs
NCBI-GeneID: 26909
NCBI-ProteinID: NP_036142
MGI: 1349427
Ensembl: ENSMUSG00000039748
Vega: OTTMUSG00000050253
UniProt: Q9QZ11
Position
1 H4; 1 81.9 cM
AA seq 837 aa
MGIQGLLQFIQEASEPVNVKKYKGQAVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCM
KFVNMLLSYGVKPILIFDGCTLPSKKEVERSRRERRQSNLLKGKQLLREGKVSEARDCFA
RSINITHAMAHKVIKAARALGVDCLVAPYEADAQLAYLNKAGIVQAVITEDSDLLAFGCK
KVILKMDQFGNGLEVDQARLGMCKQLGDVFTEEKFRYMCILSGCDYLASLRGIGLAKACK
VLRLANNPDIVKVIKKIGHYLRMNITVPEDYITGFIRANNTFLYQLVFDPIQRKLVPLNA
YGDDVNPETLTYAGQYVGDSVALQIALGNRDVNTFEQIDDYSPDTMPAHSRSHSWNEKAG
QKPPGTNSIWHKNYCPRLEVNSVSHAPQLKEKPSTLGLKQVISTKGLNLPRKSCVLKRPR
NEALAEDDLLSQYSSVSKKIKENGCGDGTSPNSSKMSKSCPDSGTAHKTDAHTPSKMRNK
FATFLQRRNEESGAVVVPGTRSRFFCSSQDFDNFIPKKESGQPLNETVATGKATTSLLGA
LDCPDTEGHKPVDANGTHNLSSQIPGNAAVSPEDEAQSSETSKLLGAMSPPSLGTLRSCF
SWSGTLREFSRTPSPSASTTLQQFRRKSDPPACLPEASAVVTDRCDSKSEMLGETSQPLH
ELGCSSRSQESMDSSCGLNTSSLSQPSSRDSGSEESDCNNKSLDNQGEQNSKQHLPHFSK
KDGLRRNKVPGLCRSSSMDSFSTTKIKPLVPARVSGLSKKSGSMQTRKHHDVENKPGLQT
KISELWKNFGFKKDSEKLPSCKKPLSPVKDNIQLTPETEDEIFNKPECVRAQRAIFH
NT seq 2514 nt   +upstreamnt  +downstreamnt
atggggattcaagggttacttcagttcatccaagaagcttctgaacctgtcaacgtgaag
aagtacaaaggacaggcagtggctgtggatacctactgttggcttcacaaaggggctatt
gcttgtgctgaaaagctagccaaaggggaacctacagataggtatgtaggattttgtatg
aagtttgttaatatgctgctgtcttatggggtcaagccgattctcatatttgacggatgt
actctaccttctaaaaaggaagtggagcggtctcgaagagagagacgacaaagcaacctt
cttaaagggaagcagcttcttcgagagggcaaagtgtcagaagcccgagactgcttcgct
cgctctatcaacatcacgcacgccatggcccacaaagtaataaaagctgctcgggcccta
ggagtggattgcctcgtggctccgtatgaagctgatgctcagttggcctaccttaacaag
gctggcatcgtgcaggctgtcatcacagaggactctgacctcctcgcatttggctgtaag
aaggtgattttaaaaatggatcagtttggaaatggactggaagtggaccaggcacggcta
ggcatgtgcaagcagcttggggatgtattcacggaggagaagttccggtacatgtgcatt
ctgtccggctgtgactacctcgcctcccttcgtgggatcggcttagccaaggcctgcaaa
gtgctgagactggccaataaccccgatatcgtgaaggttatcaagaaaattgggcattat
ctcaggatgaatataacggtgcccgaggattacatcacaggatttattcgtgccaacaat
actttcctctaccagctcgtgttcgaccccatccaaaggaagctggtccctctgaatgcc
tacggagatgacgttaatcccgaaacactgacttacgctgggcagtacgtcggtgactct
gtagctcttcagatcgcccttggaaatagagatgtaaatacttttgaacagattgatgac
tacagtccagacaccatgccagcccactcaagaagccacagctggaatgagaaagcaggt
cagaaaccacctggtaccaacagcatttggcacaagaattattgtcctagacttgaggtg
aacagtgtctcccacgctcctcaactgaaggaaaagccaagcactttgggccttaaacaa
gtgattagtactaaagggttaaatcttcccaggaagtcttgtgtgttgaaaagaccaaga
aatgaagcgctggctgaagatgacctgttgagccagtattcgtcagtttcaaagaagatc
aaggaaaatggctgtggggatggcacatcacctaactcttctaaaatgtccaagtcctgc
cccgattctgggactgctcacaagacagatgcacacaccccgtctaagatgaggaataaa
tttgcaacgttcttacagaggaggaatgaagaaagcggtgcagtcgtggttccagggacc
agaagcaggtttttttgcagttctcaggattttgacaatttcataccaaaaaaagaaagc
ggccagcctctaaatgaaactgtggccactggcaaagccaccaccagcctcctcggggca
ctggactgtccagacacggaaggccacaagccggttgatgcaaatgggacgcacaatctg
agctctcagattccaggcaatgcagctgtgtctcctgaggatgaggctcagtcctctgag
accagcaaactcttgggggccatgtccccacccagtctggggacactaagaagctgtttc
agttggtctggcactctcagggaattttctcgaactccaagtccctcagcaagcactaca
ttgcagcagttccggagaaagagcgacccccctgcctgtcttcctgaggcctctgccgtg
gtcactgacaggtgcgactcaaagagcgagatgctgggtgagacgtctcagcccttgcac
gagctgggctgctcctcgcggtctcaggaaagcatggactcctcgtgcggcctaaacacg
tcgagcctgtcccagccttccagtagggattcaggttcagaggagtcggattgtaacaat
aagtcacttgataatcaaggggaacagaactccaagcaacacttacctcacttttcaaag
aaagacggacttagacggaacaaggttcctgggctctgtaggtctagttctatggactct
ttttctacaaccaagatcaagcccctggtgcctgccagggtcagtggcctgagcaagaag
tcaggaagcatgcagacgagaaaacaccatgatgtggagaacaagccaggcctacagacg
aagatcagcgagctctggaaaaactttgggtttaaaaaagattctgaaaagcttccttct
tgtaagaagcccctgtctccagtcaaggacaatatccaactcactccagagacagaagat
gagatctttaacaagcccgagtgtgtacgcgctcagagagcaatatttcactaa

DBGET integrated database retrieval system