KEGG   Mus musculus (mouse): 269113
Entry
269113            CDS       T01002                                 

Symbol
Nup54, 3110079L04Rik, 54kDa
Name
(RefSeq) nucleoporin 54
  KO
K14308  nuclear pore complex protein Nup54
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    269113 (Nup54)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    269113 (Nup54)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    269113 (Nup54)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     269113 (Nup54)
SSDB
Motif
Pfam: Nup54 Nup54_C XhlA FAST_2
Other DBs
NCBI-GeneID: 269113
NCBI-ProteinID: NP_899248
MGI: 1920460
Ensembl: ENSMUSG00000034826
Vega: OTTMUSG00000028742
UniProt: Q8BTS4
Position
5:complement(92563399..92583117)
AA seq 510 aa
MAFNFGAPSGTSGTSTATAAPAGGFGGFGTTTTTAGSAFSFSAPTNTGSTGLLGGTQNKG
FGFGTGFGTTTGTGTGLGTGLGTGLGFGGFNTQQQQQQQQTSLGGLFSQPTQAPAQSTQL
INTASALSAPTLLGDERDAILAKWNQLQAFWGTGKGYFNNNIPPVEFTQENPFCRFKAVG
YSCMPNNKDEDGLVVLIFNKKETDIRSQQQQLVESLHKVLGGNQTLTVNVEGIKTLPDDQ
TEVVIYVVERSPNGTSRRVPATTLYAHFEQANIKAQLQQLGVTLSMTRTELSPAQIKQLL
QNPPAGVDPIIWEQAKVDNPDSEKLIPVPMVGFKELLRRLKVQDQMTKQHQTRLDIISED
ISELQKNQTTTMAKIAQYKRKLMELSHRTLQVLIKQEIQRKSGYAIQADEEQLRVQLDTI
QGELNAPTQFKGRLNELMSQIRMQNHFGAVKSEEKYYIDADLLREIKQHLKQQQEGLSHL
ISIIKDDLEDIKLVEHGLNETIHSRGGVFS
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggctttcaattttggggctccttcgggcacttcgggcacctctacagccaccgcggca
ccggcgggtgggtttggaggatttggaacaacaactacaactgcaggctctgccttcagc
ttttcagccccaacaaacacaggcagtacaggccttctcggtggcactcagaacaaaggt
tttggctttggtactggttttggcacaacgacgggaactggcactggtttaggcactggc
ttgggaaccggacttggatttggaggatttaatacccagcagcagcagcagcagcagcag
acttctttaggtggtctcttcagtcagccgacccaggctcctgcacagtctacccagctc
atcaacactgccagcgcactttctgctccaacgctactgggggatgagagagacgccatc
ttggcaaagtggaaccagttgcaggccttctggggaacaggaaaaggatatttcaataat
aacattcctccagtggagtttacccaggagaatcccttttgccggtttaaggctgtaggc
tatagttgtatgcccaataataaagatgaagatggactagtagttttaattttcaacaaa
aaagaaacagatattagaagccagcaacagcaattggtagaatcattgcataaagttttg
ggaggaaaccagacccttacggtcaatgtggagggcattaagacgttgccggatgatcag
acggaagttgtcatttatgttgttgagcgttctccaaatggcacctcgagaagagttcca
gcgacaacactgtatgcccactttgagcaagccaacattaaagcccagctgcagcagctt
ggggtgaccctttctatgaccaggacagagctgtctcccgctcagatcaagcagctctta
caaaaccctcccgcaggtgttgatcctattatttgggaacaggccaaggtggataaccca
gactctgaaaagttaattcctgtaccaatggtgggtttcaaagaattgcttcgaagactg
aaggttcaagatcagatgactaagcagcatcagaccagactagatatcatatctgaagat
attagtgaactgcaaaaaaatcaaactacgactatggccaaaatagcacaatacaagagg
aaactgatggagctctcccacaggaccttacaggtcctaatcaaacaggaaatccagagg
aagagtggctatgcgatccaggctgatgaagagcagttgcgggttcagctagatactatt
caaggggaactgaatgcgcccactcagttcaaaggtcggctgaatgagctgatgtcccag
atcaggatgcagaatcattttggagccgtgaaatctgaagaaaagtactacatagatgca
gacctgttacgagaaatcaagcagcatttgaaacaacaacaggaaggccttagccacttg
attagcatcataaaagatgacctagaagacataaaactggtagaacatggattgaatgag
accatccatagcagaggcggtgtctttagctga

DBGET integrated database retrieval system