KEGG   Mus musculus (mouse): 26919
Entry
26919             CDS       T01002                                 

Symbol
Zfp346, Jaz, Znf346
Name
(RefSeq) zinc finger protein 346
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz zf-U1 zf-C2H2_2 zf-C2H2_4 Rad50_zn_hook TUTase
Other DBs
NCBI-GeneID: 26919
NCBI-ProteinID: NP_036147
MGI: 1349417
Ensembl: ENSMUSG00000021481
Vega: OTTMUSG00000035039
UniProt: Q9R0B7
Position
13; 13 B1
AA seq 294 aa
MECPAPDATDAADPGEAGPYKGSEEPEGREPDGVRFDRERARRLWEAVSGAQPAGREEVE
HMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETIKGDVKRL
DSDQKSSRSKDKNHCCPICNMTFSSPAVAQSHYLGKTHAKSLKLKQQSTKGAALQQNREM
LDPDKFCSLCHSTFNDPAMAQQHYMGKRHRKQETKLKLMAHYGRLADPAVSDLPAGKGYP
CKTCKIVLNSIEQYQAHVSGFKHKNQSPKTLVTLGSQTPVQTQPTPKDSSTVQD
NT seq 885 nt   +upstreamnt  +downstreamnt
atggagtgtcctgcgcccgatgctacggatgctgcggaccctggagaagccggaccgtac
aagggctccgaggagccggagggtcgggaaccggacggagtgcgctttgaccgcgagagg
gcgcgtcgcctgtgggaagctgtgtccggtgcgcagccggcggggagggaggaagtggaa
cacatgatccagaagaaccagtgtctcttcaccagcacccagtgtaaggtctgctgtgcc
atgctgatttctgagtctcagaagctggcgcattaccagagcaaaaaacatgccaacaaa
gtgaagagatacctagcaatccatggaatggagacaataaagggggacgtgaagaggcta
gactcagatcagaagagcagcagaagcaaagacaagaaccactgctgccccatctgtaac
atgaccttttcctcccctgctgtggcacagtcgcactacctggggaagacccacgcaaag
agcctaaagctgaagcagcagtccactaagggggcagccttgcagcagaatagagagatg
ctagacccagacaaattctgcagcctctgccattcaacattcaacgaccctgccatggct
cagcaacattatatgggcaagagacacaggaagcaggagactaagctcaaactcatggca
cactatgggcggctggcggaccctgctgtctctgacttaccagctgggaagggctacccc
tgcaagacgtgtaaaatagtgctgaactccatagagcagtaccaagctcacgtcagtggc
ttcaaacacaaaaaccagtcacccaaaacattggtgacactcgggagccagacgccagtg
caaacacaacccactccaaaggactcaagcacagtgcaagactaa

DBGET integrated database retrieval system