KEGG   Mus musculus (house mouse): 269209
Entry
269209            CDS       T01002                                 
Symbol
Stk36, 1700112N14Rik, B930045J24, FU, Fused, mKIAA1278
Name
(RefSeq) serine/threonine kinase 36
  KO
K06228  fused [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    269209 (Stk36)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    269209 (Stk36)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     269209 (Stk36)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   269209 (Stk36)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Other motile cilia associated proteins
   269209 (Stk36)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr HEAT HEAT_2 HEAT_EZ Cnd1 Kinase-like ABC1 Pkinase_fungal Haspin_kinase APH Arm Kdo
Other DBs
NCBI-GeneID: 269209
NCBI-ProteinID: NP_778196
MGI: 1920831
Ensembl: ENSMUSG00000033276
UniProt: Q69ZM6
Position
1:74640583..74676053
AA seq 1316 aa
MEKYHVLEMIGEGSFGRVYKGRKKYSAQVVALKFIPKLGRSEKELRNLQREIEIMRGLWH
PNIVHMLDSFETDKEVVVVTDYAEGELFQILEDDGKLPEDQVQAIAAQLVSALYYLHSHR
ILHRDMKPQNILLAKGGGIKLCDFGFARAMSTNTMVLTSIKGTPLYMSPELVEERPYDHT
ADLWSVGCILYELAVGTPPFYTTSIFQLVSLILKDPVRWPSTISSCFKNFLQGLLTKDPR
QRLSWPDLLHHPFIAGRVTIITEPAGSDLGTPFTSRLPPELQVLKDEQAHRLAPKGNQSR
ILRQACKLMAEEAKQKEDQNAGSALEQEDGLCKVTPSTAPVPGLKATPQESSLLAGILAS
EMKNNWEDWGAGEAPRTSRENHINLECEQGFPEPRPEAMGRQSTDVVDPENEEPDSDDEW
QRLLETSEPGPVQLKSPLTLLCNPDFCQRIQSQLRGTGEQILKGVLDGVSHLLPVLRILS
SLLSSCNDSVLLYSFCQEAGLPELPLSLLRYSQESSSIQQQPWYGALLRDLVAVVQAYFS
CTFNLERSQTGDSLQVFQEAASLFLDLLGKLLAQSDDSEQTFRRDSLMCFAVLCEAVDGN
SWAVSKAFYSSLLTTQRAVLDGLLHGLTVPQLPFHTPPGAPQVSQPLREQSEDVPGAISS
ALAAMCTAPVGLPSCWDAKEQVSWHLANQLTEDSSQLRPSLISGLRHHVLCLHLLKVLYA
CCYISERLCHILGQEPLALESLLMLVQGKVKVADWEESTEVALYLLSLLVFRLQDLPSGM
EKLGSEVATLFTHSHVVSLVNAAACLLGQLGQQGVTFDLQPREWIAAAAHALSAPAEVRL
TPPYSCGFYDGLLILLLQLLMQVQGKPGLIRDVVGSEVWTILWHRFSMALRLPEEVSAQE
DDLLLSSPSSLEPDWTLISPQGMAALLSLAMAIFTQESQLCLSHLSQHGSVLMLTLKHLL
SPSFLHHLSQAPQGPEFLPVVVLSVCKLLCFPFALDVDADLLVGVLADLRASEVVVCLLQ
VCCHHLSLLQAELPIGLLTRLALTDSASLKQFVNTVATSSRAIISFLSVVLLSDQPLMIS
DLLSLLTHTARILSPSHLSFIQELLSGSDESYRPLRSLLGHSENTVRVRAYGLLGHLLQH
SMALRGALQSQSGLLNLLLLGLGDKDPAVRRSASFAVGNAAYQAGPLGPALAAAVPSMTQ
LLGDAQDGIRRNAASALGNLGPEGLGKELLKCQVPQRLLEMACGDPQPTVKEAALIALRS
LQQESCIHQVLVSLGASEKLALLSLGNQLLPNSSNRPASVRHCRKLIQLLRPTHST
NT seq 3951 nt   +upstreamnt  +downstreamnt
atggaaaagtaccacgttttggagatgattggagaaggctcttttgggagagtgtataag
ggccgaaaaaaatacagtgctcaggtggtggccttgaagttcatccccaaactggggcgc
tcagagaaagagctgaggaatctgcaacgagagattgaaatcatgcggggtctgtggcat
cccaacattgtgcatatgctcgacagctttgagactgacaaagaggtggtggtggtgaca
gactacgctgaaggagaactctttcagattctggaagatgatggaaaacttcctgaagac
caggttcaggccatcgctgcccagttggtgtcagctctgtactacctgcattcccaccgc
atcctacaccgcgacatgaaaccgcagaacattcttctcgccaagggtggtggcattaaa
ctttgtgactttggattcgcccgagctatgagcaccaacaccatggtgctgacgtcgatc
aaaggcacaccgctctatatgtctccagagctggtggaggagcgaccatatgaccacacc
gcagacctctggtctgtgggctgcatcctgtatgagctggctgtcggcacgcctcccttc
tacaccaccagcatctttcagctggttagcctcattctcaaggaccctgtgcgctggccc
tccaccattagttcctgcttcaagaacttcttgcaggggctgctcaccaaggacccccgg
cagcgtctgtcctggccagacctcttacatcacccctttattgccggccgtgtcaccatc
ataactgaaccagcaggctccgatttgggcaccccatttactagtcgcctacccccagaa
cttcaggtcctcaaggatgaacaggcgcatcggctcgcacccaagggtaaccagtctcgc
atcctgcgccaggcctgtaaactcatggctgaagaagccaagcagaaggaagaccaaaat
gcaggatctgcccttgaacaagaagacgggctctgcaaggtgacacccagcacagccccc
gtgcctggactaaaggccactcctcaggagtcaagcctcttggctggtatactggcttca
gaaatgaagaacaactgggaagactggggggctggagaagcaccccgtacctctcgggaa
aaccacatcaacctggagtgtgaacaaggcttcccagagccgaggccagaggcgatgggc
cggcagagcactgatgtagtggatcctgaaaatgaggagccagacagtgatgatgagtgg
caacgcctactagagaccagcgagcctgggcctgtgcagctgaagtcccccctcaccctg
ttgtgtaaccctgacttctgccagcgcatccagagtcagctgcgcgggactggcgagcag
atcctgaaaggcgttctggatggtgtgtcccacctccttcctgtactccgcatcctgagt
agtctcctatccagctgcaatgactctgtgctcttgtattccttctgccaggaggcagga
ctgcctgagctgcctctcagccttcttaggtacagccaggagagtagcagcatccagcag
caaccttggtatggggcgctcttacgggacctggtggctgtggttcaggcctacttttcg
tgcaccttcaatctggagaggagccagacaggtgacagcctacaggtgtttcaggaggcc
gccagcctctttttggacctgttggggaagctgctggcccaatcagatgattccgagcag
acatttcgaagggatagccttatgtgctttgctgtcttgtgtgaagctgtggacggaaac
agctgggccgtctccaaagccttctactccagcctgttgaccacacagcgcgctgtgttg
gatggcctccttcacggcctgacagtcccacagcttcctttccacacaccaccaggagcc
ccacaagtgagccagccgctgcgggagcagagtgaagatgtacctggagccatctcttct
gccctggcagccatgtgtactgctcctgtggggctgcccagctgttgggatgccaaggag
caggtctcttggcatttggccaaccagctaactgaagacagcagccaactgaggccatcc
ctcatctctggtctgcgacaccatgtcctgtgcctccaccttctcaaggttctctacgcc
tgctgctatattagtgagcgcctgtgccatattctggggcaagagcccctggccttggag
tcgctgctgatgttagtccagggcaaggtgaaagtagcagattgggaagagtccactgag
gtggcactttacctcctgtcccttcttgtctttcggctccaagatctgccttcagggatg
gagaagctgggcagtgaggttgctactctctttacccactcacatgtcgtctctcttgtg
aatgcggcagcctgtctcttaggacagcttggtcagcaaggggtgacctttgacctccag
ccccgggaatggattgctgcagctgcacatgccttgtctgcccctgcagaggtccggctg
actccgccgtatagttgtggcttctatgatggcctcctcattctcctgcttcagcttctt
atgcaggtacaggggaagcctggcctgatcagggatgtggttggttcagaggtgtggacc
attctgtggcaccgcttttccatggccctgaggctgcccgaggaggtgtctgcccaggaa
gacgacctgctactatcaagtccctccagcctagagccagactggacactgatttcaccc
caaggcatggcagccttgctgagcctggccatggccatcttcacccaggagtcccagtta
tgcctgagccacctgtcccagcatggcagtgtcctcatgctgaccctgaagcacctgctt
tcacccagcttcttgcaccacctgagccaggcgccgcaggggcccgagtttctccccgtt
gtggtgctctccgtgtgcaagctgctctgcttcccttttgccctggatgtggatgctgac
ctccttgtaggtgtcttggctgacctcagggcctcggaagtggtagtctgcctgctgcag
gtctgctgccaccacctttcgttgttacaagcagagctgcccattggcctccttacacgc
ctggccctcacggattctgcctctctcaagcagtttgtgaacacagtggccacctcttct
agagccatcatctcattcctctctgttgttctcctgagtgaccagcccctcatgatctct
gacctcctgtccctgctgacacacacagcccggattctgtcccccagccacttgtccttt
atccaagagctcctgtctggctctgatgaatcctatcggccattgcgcagcctcctaggc
cactcagagaacactgtgcgggtccgtgcatatgggctcctgggacatttattacagcac
agcatggccctacgtggggcactacagagtcagtcaggactgctcaaccttctgctgcta
gggcttggagacaaggaccctgccgtgcgacgcagtgccagctttgctgtgggcaatgca
gcctaccaggctgggcctttgggacctgccttggcagctgcagtgcccagtatgacccag
ctgcttggagatgctcaggatgggatccggcgcaatgctgcatcagctctaggcaatctg
ggacctgaaggattgggcaaggagctattaaagtgccaagtaccccagcggctcctagaa
atggcatgtggagaccctcagccaactgtcaaagaggctgccctcattgcccttcgaagc
ctccaacaggagtcctgtattcatcaggtgctggtgtcgctgggtgccagtgagaagtta
gccttgctctctttggggaatcagttactgccgaatagcagcaacaggcctgcctccgtc
agacactgcaggaagctcatccaactcctgaggccaacccacagcacatga

DBGET integrated database retrieval system