KEGG   Mus musculus (mouse): 269233
Entry
269233            CDS       T01002                                 

Gene name
Fam171a1, 9630050M13Rik, AA409679
Definition
(RefSeq) family with sequence similarity 171, member A1
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: UPF0560
Other DBs
NCBI-GeneID: 269233
NCBI-ProteinID: NP_001074630
MGI: 2442917
Ensembl: ENSMUSG00000050530
Vega: OTTMUSG00000010785
UniProt: A2ATK9
Position
2; 2 A1
AA seq 892 aa
MSKSAALLLCLLGCHVWKAVTKTLQEPGAGAQEVTLKVHISDASTHQPIADALIEIFASQ
VSVASGTSGTDGVAFIKFPYKLGNQLIVTATKQAYVPNSAPWKPIRLPVFSSLSLGLLPE
RSATLMVYEDVVQIVSGFQGARPQPRVHFQRRALRLPENTSYSDLTAFLTAASSPSEVDS
FPYLRGLDGNGTGNSTRYDLTPVTAVSVHLLSGNGMPVLVDGPIYVTVPLATQSSLRHNA
YVAAWRFDQKLGTWLKSGLGLVHQEGSQLTWTYIAPQLGYWVAAMSPPIPGPVMTQDITT
YHTVFLLAILGGMAFILLVLLCLLLYYCRRKCLKPRQHHRKLQLPPALESSKRDQATSMS
HINLLFSRRASDYPGPLSVSSHSRPEAPGTKELMGGVHLEMMSPKGEGDLHTPMLKLSYS
TSQEFSSREELLSHKEEDKSQTSFDNLTPSGTLGKDYHKSVEIFPLKARKSMEKEDYEAP
GNDDYRGSYNTVLSQSLFEKQDQEGLASAGSKLTIQEHMYHVPLSPEKEQLLDRRPTECM
MSRSVDHLERPTSFPRPGQLICCSSVDQVNDSVYRKVLPALVIPAHYMKLPGDHSYVSQP
LVVPADQQLEIGRLQAELSNPHAGIFPHPSSQIQGQPLSSQAISQQHLQEAGAREWSSQS
ASMSESLSIPASLNDAALAQMNSEVQLLTEKALMELGGGKPLPHPRAWFVSLDGRSNAHV
RHSYIDLQRAGRNGSNDASLDSGVDMNEPKSARKGRGDPLSLQQSHTPLQEHQQKDPRAP
DSTACTQLLYLEDMDPSGSECAATVCTPEDSALRCLLEGSGRRSGGQLPSLQEETTKRTS
DVPLEPLASPNQRRSANDEDEDDDDDDDDQGEDKKSPWQKREERPLMAFNIK
NT seq 2679 nt   +upstreamnt  +downstreamnt
atgagcaagtccgctgcgctgctgctctgcctgctcggctgccacgtttggaaggcagtc
accaagacgctgcaggagcccggcgcgggagcccaagaggtgaccttgaaggtgcacatt
agtgacgccagcacccaccagcccatcgcagatgcgctcattgagatcttcgccagccag
gtgtctgttgcctctggcacatctggcacagatggggttgctttcatcaagttcccatac
aagcttggaaatcagctgattgtcactgccacaaaacaggcctacgtgccaaactctgcc
ccgtggaagcccatccgattaccggtgttttcctcactgagccttggcctgcttcctgaa
cgctccgctacgctgatggtctatgaagatgtcgtccaaatagtctcaggattccaaggt
gcccggccacagcctcgagttcatttccagagaagggccttgaggttgccggagaacacc
agctacagcgacctaacagcgttcctcactgcggccagctccccatcagaagtggacagc
ttcccttacttgcgaggattggatggaaacgggacaggaaacagcaccaggtatgacttg
actcctgtcacagccgtcagcgtgcacttgctcagcggtaatgggatgccggtgctggtg
gacggacccatctatgtcactgtgcccttggccactcagagcagtctgaggcacaatgcc
tatgtcgcagcatggcggtttgaccagaagctgggaacgtggctgaagagtggtctgggc
ctggtgcaccaggaaggcagtcagctcacgtggacgtacattgctccccagctggggtac
tgggtggcagccatgtctccccccatcccaggtcccgttatgacacaggacattaccacg
tatcacacggtgtttcttttggccattttaggaggaatggctttcattcttttggttttg
ctgtgtctccttttatattattgcaggaggaagtgcttgaaaccccgccagcatcacaga
aagctgcaactgcccccagctctggagagctccaagagggatcaggcaacatccatgtct
cacatcaacttgctgttttctcgacgagcatcagattatcctgggcctctgtctgtctcc
agccatagccgcccagaggccccagggacaaaggagttgatgggcggggtgcatttagaa
atgatgtcccccaaaggggagggggacctgcacacacccatgctgaagctctcctatagt
acctcacaagaatttagctcccgggaggagctgctgtcccacaaagaagaggataaaagc
caaacatcttttgataacttaacgccaagtgggacactggggaaagactaccataagtct
gtggagatttttcccttaaaggcaagaaaatctatggaaaaagaagactacgaggcccct
ggcaatgatgactacagaggtagttacaataccgtgctctcccagtctttgtttgaaaag
caagatcaagaaggcctggcatcagcaggaagcaaactcactattcaggaacacatgtac
catgtacctttatcgcctgagaaagagcaactgctggaccgcagaccgactgaatgtatg
atgtcacgatctgtcgatcacctggagagacctacttccttcccgaggccaggccagttg
atctgctgtagttctgtggaccaagtcaatgacagcgtttacaggaaagtattgcctgcc
ttggtcattccagctcattatatgaaacttccaggggaccactcgtatgtgagccagcct
ctggtggtcccggctgaccagcagctggaaataggaaggctccaggccgagctgtccaac
ccccatgcagggatcttcccacacccatcctctcagatccaaggccagcctttgtcttcc
caggctatctctcagcagcacctacaggaagcaggtgcacgggagtggagctctcagagt
gcatccatgtcagagtcactgtctatccctgcatccctgaatgatgcagctttggctcaa
atgaacagcgaggtgcagctcctcaccgaaaaggcactgatggaacttgggggtggaaag
ccacttccacaccctcgggcatggtttgtctccctagatggaaggtccaacgctcacgtt
agacactcatacattgatctccaaagagctggaaggaacggaagtaatgatgccagtttg
gactctggtgtggatatgaatgaaccaaaatctgcccggaagggaaggggagaccctttg
tctctccagcagagccacacacctctgcaggagcaccagcaaaaagatcccagagctccc
gacagcactgcctgcacgcagctcctgtaccttgaggacatggacccgagcggcagtgag
tgtgcagccacggtctgcacccccgaggacagtgcactgcgatgcttgttggaagggtca
ggtcggaggagtggcgggcagctgcccagcctgcaggaagagacaaccaaacgaacttca
gacgttcccctggagccattagccagtcccaaccagagaagatccgccaatgatgaagat
gaagatgacgatgacgatgacgatgaccaaggagaagataagaaaagcccctggcagaaa
cgagaggaaaggcccttgatggccttcaacatcaaatga

DBGET integrated database retrieval system