KEGG   Mus musculus (house mouse): 26926
Entry
26926             CDS       T01002                                 
Symbol
Aifm1, AIF, AIFsh2, Hq, Pdcd8
Name
(RefSeq) apoptosis-inducing factor, mitochondrion-associated 1
  KO
K04727  apoptosis-inducing factor 1 [EC:1.-.-.-]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04210  Apoptosis
mmu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    26926 (Aifm1)
   04217 Necroptosis
    26926 (Aifm1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.-  
   1.-.-
    1.-.-.-
     26926 (Aifm1)
SSDB
Motif
Pfam: AIF_C Pyr_redox_2 Pyr_redox Pyr_redox_3 HI0933_like AIF-MLS Amino_oxidase FAD_oxidored Lys_Orn_oxgnase
Other DBs
NCBI-GeneID: 26926
NCBI-ProteinID: NP_036149
MGI: 1349419
Ensembl: ENSMUSG00000036932
UniProt: Q9Z0X1
Structure
Position
X:complement(47563821..47602440)
AA seq 612 aa
MFRCGGLAGAFKQKLVPLVRTVYVQRPKQRNRLPGNLFQQWRVPLELQMARQMASSGSSG
GKMDNSVLVLIVGLSTIGAGAYAYKTIKEDQKRYNERVMGLGLSPEEKQRRAIASATEGG
SVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWF
SDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGN
MVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVK
SITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGV
KVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGF
RVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSM
FWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEI
TIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDL
NEVAKLFNIHED
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgttccggtgtggaggcctggcgggtgctttcaagcagaaactggtgcccttggtgcgg
acggtgtacgtccagaggccgaaacagaggaaccggcttccaggcaacttgttccagcaa
tggcgtgttcctctagaactccagatggcaagacaaatggctagctctggttcatcaggg
ggcaaaatggataattctgtgttagtccttattgtgggcttatcaacaataggagctggt
gcatatgcctacaaaactataaaagaagaccaaaaaagatacaatgaaagagtgatggga
ttaggactgtccccagaagagaaacagagaagagccattgcctccgctacagagggaggc
tcagttcctcagatcagggcaccaagtcacgtccctttcctgctgattggtggagggact
gctgcttttgcagcagccagatccatccgggctcgggatcctggggccagggtcctgatt
gtatctgaagaccctgaactgccatacatgcgacctcctctttcaaaagaattgtggttt
tcagatgatccaaatgtcacaaagacactgcaattcagacagtggaatggaaaagagaga
agcatatatttccagccaccttctttctatgtctctgctcaggacctgcctaatattgag
aacggtggtgtggctgtcctcactgggaaaaaggtagtacatctggatgtaagaggcaac
atggtgaaacttaatgatggctctcagattacctttgaaaagtgcttgattgcaacggga
ggcactccaagaagtctgtctgccatcgatagggctggagcagaggtgaagagtagaaca
acacttttcaggaagattggagattttagagccttggagaagatctctcgggaggtcaag
tcaattacagttatcggcgggggcttccttgggagtgagctggcctgtgctcttggcaga
aagtctcaagcctcgggcatagaagtgatccagctgttccctgagaaaggaaatatgggg
aagatccttcctcaatacctcagcaactggaccatggaaaaagtcaaacgagagggagtg
aaagtgatgcccaatgcaattgtacaatcagttggagtcagcggtggcaggttactcatt
aagctgaaagatggaaggaaggtagaaactgaccacatagtgacagctgtgggcctagag
cccaatgttgagttggccaagactggcggactggaaatagattccgattttggtggcttc
cgggtaaatgcagaactccaagcacgttctaacatctgggtggcaggggatgctgcatgc
ttctatgatataaagttgggtcgaaggcgagtagagcatcatgatcatgctgttgtgagt
ggaagactggctggagaaaacatgactggagccgctaagccatactggcatcagtcaatg
ttctggagtgatttgggtcctgatgtcggctatgaagctattggtctggtggatagtagt
ttgcccacagttggtgtttttgcaaaagcaactgcacaagacaacccaaaatctgccaca
gagcagtcaggaactggtatccgttcggagagtgagacagagtcagaagcttcggaaatc
acaattcctcccagcgcccctgcagtcccacaggtccctgttgaaggggaggactacggc
aaaggtgtcatcttctacctcagggacaaagttgtggtggggattgtgctatggaacgtc
tttaaccgaatgccaattgcaaggaagatcattaaggacggtgagcaacatgaagatctc
aatgaagtagctaaactcttcaacattcatgaagattga

DBGET integrated database retrieval system