KEGG   Mus musculus (mouse): 269336Help
Entry
269336            CDS       T01002                                 

Gene name
Ccdc32, Gm631
Definition
(RefSeq) coiled-coil domain containing 32
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: CCDC32
Motif
Other DBs
NCBI-GeneID: 269336
NCBI-ProteinID: NP_955014
MGI: 2685477
Ensembl: ENSMUSG00000039983
Vega: OTTMUSG00000015768
UniProt: Q3UHY7
Position
2; 2 E5
AA seq 179 aa AA seqDB search
MKMFESLDSSATKSGRDLWAEICSCLPSPAQEDVSDNAFSDSFMDSHPAGESHTAAADSA
VQPAGKPWAPLHDSEVYLASLEKKLRRIKGLNEEVTSKDMLRTLAQAKKECWDRFLQEKL
ASEFFVDGLDSDESTLEHFKRWLQPDKVAISTEEVQFLIPPESQAEKPEAGDKPAAAEQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgtttgagagccttgactcttcggctacaaagtctggccgggatctctgggct
gaaatttgttcttgtctgccaagtcctgcccaagaagatgtttccgacaatgccttctcg
gactccttcatggactcccatcctgcaggggaaagccatacagcagcagcagactctgct
gtccagccagctggaaagccgtgggctcccttgcatgattcagaagtgtatttagcatct
ctagagaagaaactaagaagaatcaaaggtttaaatgaggaagtaacttccaaggacatg
cttcgaactctggcccaagctaagaaggagtgctgggatcgattcctccaggagaagtta
gcatcagagttttttgtggatggactcgattccgatgagagcaccttggaacatttcaaa
aggtggctccagccagataaagtcgccatcagcacagaggaggtccagttcctcatccct
ccggagtcgcaggctgagaagcccgaggccggggacaagccagcggcagcagaacaataa

DBGET integrated database retrieval system