KEGG   Mus musculus (mouse): 269338Help
Entry
269338            CDS       T01002                                 

Gene name
Vps39, A230065P22Rik, AW743070, Vam6, Vam6P, mVam6
Definition
(RefSeq) VPS39 HOPS complex subunit
  KO
K20183  Vam6/Vps39-like protein vacuolar protein sorting-associated protein 39
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    269338 (Vps39)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    269338 (Vps39)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vps39_2 Vps39_1 CNH Clathrin Hira
Motif
Other DBs
NCBI-GeneID: 269338
NCBI-ProteinID: NP_671495
MGI: 2443189
Ensembl: ENSMUSG00000027291
Vega: OTTMUSG00000015284
UniProt: Q8R5L3 Q5KU38 Q3USV9
Position
2; 2 E5
AA seq 886 aa AA seqDB search
MHDAFEPVPILEKLPLQIDCLAAWEEWLLVGTKQGHLLLYRIRKDVVPADVASPESGSCN
RFEVTLEKSNKNFSKKIQQIHVVSQFKILVSLLENNIYVHDLLTFQQITTVSKAKGASLF
TCDLQHTETGEEVLRMCVAVRKKLQLYFWKDREFHELQGDFSVPDVPKSMAWCENSICVG
FKRDYYLIRVDGKGSIKELFPTGKQLEPLVAPLADGKVAVGQDDLTVVLNEEGICTQKCA
LNWTDIPVAMEHQPPYIVAVLPRYVEIRTLEPRLLVQSIELQRPRFITSGGSNIIYVASN
HFVWRLIPVPMATQIQQLLQDKQFELALQLAEMKDDSDSEKQQQIHHIKNLYAFNLFCQK
RFDESMQVFAKLGTDPTHVMGLYPDLLPTDYRKQLQYPNPLPTLSGAELEKAHLALIDYL
TQKRSQLVKKLNDSDHQSSTSPLMEGTPTIKSKKKLLQIIDTTLLKCYLHTNVALVAPLL
RLENNHCHIEESEHVLKKAHKYSELIILYEKKGLHEKALQVLVDQSKKANSPLKGHERTV
QYLQHLGTENLHLIFSYSVWVLRDFPEDGLKIFTEDLPEVESLPRDRVLNFLIENFKALA
IPYLEHIIHVWEETGSQFHNCLIQLYCEKVQSLMKDYLLSLPTGKSPVPAGEEGGELGEY
RQKLLMFLEISSHYDPGRLICDFPFDGLLEERALLLGRMGKHEQALFIYVHVLKDTKMAK
EYCHKHYDQNKEGNKDVYLSLLRMYLSPPSIHCLGPIKLELLEPQANLQAALQVLELHYS
KLDTTKAINLLPANTQINDIRIFLEKVLEENAQKKRFNQVLKNLLHAEFLRVQEERILHQ
QVKCIITEEKVCMVCKKKIGNSAFARYPNGVVVHYFCSKEVNSADT
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgcatgacgctttcgagccggtgccgatcctggaaaagcttcccctgcagatcgactgc
ctggctgcctgggaggaatggcttcttgttggaaccaagcaagggcatcttcttctctac
aggattcggaaggatgttgtgccagcagatgtagcctcacctgaaagcggcagttgtaac
aggtttgaggtaacactagagaagtccaataagaacttttccaaaaagatccagcagatc
catgtggtttcccagtttaagattctggtcagcttgttagaaaacaacatttatgtccat
gacttactgacatttcaacaaatcactacagtctcaaaggccaagggcgcatcactgttc
acctgtgacctccagcacactgagacgggtgaggaggtgttgcggatgtgtgtggcagtg
aggaagaagctgcagctgtacttctggaaggacagagaattccacgaactgcagggagac
tttagtgtgccagatgtgcccaagtccatggcatggtgtgaaaattctatctgcgttggt
ttcaagagagactattacctgatcagggtggatggaaaggggtccatcaaagagctcttc
ccaacaggaaagcagctggagcccttagttgcccctctggcagatggaaaagtggctgtg
ggtcaggatgatctgactgtggtgcttaacgaggaaggcatctgcactcagaaatgcgcc
ctgaactggacagacatcccagtggccatggagcaccagcctccatacattgttgcagtg
ttgccacgatacgtggagatccgaacactggaaccaaggcttctggtccaaagcattgag
ttgcaaaggcctcgcttcattacatcagggggatcaaacattatctatgtggccagcaat
cattttgtttggagactcattcctgtccccatggcaacccaaatccaacagcttctccag
gacaagcagtttgaattggctctgcagctcgcggagatgaaagatgactcagacagtgaa
aagcagcagcagatccatcacattaagaacttgtatgccttcaacctcttctgccagaag
cgctttgatgagtccatgcaggtctttgctaaacttggcacagatcccacccatgtgatg
ggcttgtaccccgacctactgcccacggactacaggaagcaactgcagtaccccaacccg
ctgcccacactctctggtgctgaactggagaaggctcacttagctctcattgactacctg
acacagaaacggagccagttggtaaagaagctgaatgactcggatcaccagtccagcacc
tccccgctcatggagggcactcccaccatcaagtccaagaagaagttacttcagatcatt
gacaccactctgctcaagtgctacctccatacaaatgtggccctggtggctcccttgctg
cgcctggagaacaaccactgtcatatcgaggagagtgagcatgtgctgaagaaggctcac
aagtacagcgagctgatcatcctgtatgagaagaaggggctccatgagaaagctctgcag
gtgctagtggaccagtccaagaaagcaaactcacctttgaaaggccacgagaggacggtg
cagtatctgcagcatttaggcacagaaaaccttcatctgattttttcctactcagtctgg
gtgctgagagacttcccagaagatggcctgaagatattcactgaagacctcccggaggta
gagtctctgccacgagatcgagtactcaacttcttgatagagaatttcaaggctctagcc
attccttatctggaacacatcatccacgtgtgggaggagacaggctcacagttccacaat
tgcctgatccagctgtactgtgagaaagtgcagagtctgatgaaagactaccttctgtcg
ctgcccacaggtaaaagtccagtccctgctggagaggaaggaggtgaactgggagaatac
cgacagaagctgctcatgttcttggagatttccagccactatgatccaggccggctcatc
tgtgattttccctttgatggcctcttagaagagcgagctctcctgttggggcgcatgggg
aagcacgaacaagctctcttcatctatgtccacgtcttgaaggacacaaagatggctaag
gagtactgccacaaacactacgaccaaaacaaagaaggcaacaaagatgtgtatctgtcc
ctgcttcggatgtacctgtcacctccaagcattcactgcctggggccaatcaaactggag
ctcctggagccacaggccaacctccaggctgccctgcaagtcctagagctgcactacagc
aaattagacaccaccaaggcaatcaaccttctgccagcaaacactcagatcaatgacata
cgcatctttctagaaaaggtcttagaagaaaatgcacaaaagaaacggttcaatcaagtg
cttaagaatcttctccatgcggagttcctcagggttcaggaagagcgaattttacaccag
caggtgaagtgcatcatcactgaggagaaggtgtgcatggtatgcaagaagaagattggg
aacagtgcatttgcaagataccccaatggggtggttgtgcactacttctgctccaaagag
gtaaactcagccgacacctga

DBGET integrated database retrieval system