KEGG   Mus musculus (mouse): 269356
Entry
269356            CDS       T01002                                 

Gene name
Slc4a11, AI503023, BTR1, NaBC1
Definition
(RefSeq) solute carrier family 4, sodium bicarbonate transporter-like, member 11
  KO
K13862  solute carrier family 4 (sodium borate transporter), member 11
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    269356 (Slc4a11)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   269356 (Slc4a11)
SSDB
Motif
Pfam: HCO3_cotransp PTS_EIIA_2 Band_3_cyto
Other DBs
NCBI-GeneID: 269356
NCBI-ProteinID: NP_001074631
MGI: 2138987
Ensembl: ENSMUSG00000074796
Vega: OTTMUSG00000015523
UniProt: A2AJN7
Position
2; 2 F1
AA seq 862 aa
MSQNEHCQDSGEYFSAGTQGYFKNNMEDNLEVREDSLGDEVFDTVNSSIVSGESIRFFVN
VNLEVQPSKSDLEAATGGCVLLHTSRKYLKLKNFEEEVRAHRDLDGFLAQASIILNETAT
SLDDVLRTMLNRFALDPNHAEPDCDLDLLMAKLFTDAGAPMESKVHLLSDTIQGVTATVR
GVQYEQSWLCIICTMKTLQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAM
EVARTFATMFSDITFRQKLLKTRTEEEFKEALVHQRQLLTMMMPRAAGHSMSSLHTHRHP
QPPKCKDFFPFGKGIWMDIMRRFPVYPMDFTDGIIGKSKSVGKYVTTTLFLYFACLLPTI
AFGSLNDENTNGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLAIYTQVIRVICDD
YNLDFNAFYAWTGLWNSFFLALYAFLNLSLLMNLFKRSTEEIIALFISITFVLDAVKGMV
KIFGKYYYGHHYHTKRTSSLVSLLGIGRSPNSSLHTALNASLLASPVEMATTSSPGSTHS
GQATAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVRETLSDCALPIAVLSFSLIGSYGFQ
EIEMSKFRYNPSESLFEVAQIHSLSFKAIGSAMGLGFLLSLLFFIEQNLVAALVNAPENR
LVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGHIYETIV
DVKETRLTALGASVLVGLSLLLLPFPLQWIPKPVLYGLFLYIALTSLDGNQLFSRVALLL
KEQTSYPPTHYIRRVPQRKIHYFTGLQILQLLLLCAFGMSSLPYMKMVFPLIMIAMIPIR
YNLLPRIIEAKYLDVMDAEHRP
NT seq 2589 nt   +upstreamnt  +downstreamnt
atgtcacagaatgaacactgtcaggactccggtgaatacttctcagccggcactcaggga
tacttcaagaacaacatggaggataaccttgaagtccgggaagacagcctaggggatgag
gtctttgacaccgtcaactcctccattgtgtctggcgagagcatccggttttttgtcaat
gtcaaccttgaagtgcagccctccaaatctgacttagaagctgcaacgggtggctgcgtg
ctcttacacacctctcgcaagtatctgaaattgaagaactttgaggaagaggtccgtgca
caccgggacctggatggcttcctggcccaggccagcatcatcctgaatgagacagctacc
tcactggatgatgtcctccgaactatgctaaaccgctttgccctggaccctaaccacgca
gaacctgactgtgacctggacctgctcatggctaagctctttacagatgctggagcccct
atggagagcaaggtccacctgctgtcagataccatccagggagtcactgccactgtccga
ggggtgcagtacgagcagtcttggctctgcatcatctgtaccatgaagaccctacagaaa
cggcatgtgtgcatcagccgcctggttcgaccacagaactggggggagaactcctgtgag
gttcgctttgtcatcctggtgctggccccacccaagatgaaaagcaccaagactgcaatg
gaggtggcacgcacctttgccaccatgttctcagacatcaccttccgccagaagctcctg
aagactcgcacagaggaagaattcaaggaggctctggtgcatcagagacagctgctcacc
atgatgatgccaagagccgcagggcacagcatgagctccctccatactcacagacaccct
cagcccccgaaatgcaaggactttttcccttttggaaagggcatctggatggatatcatg
cgcaggtttcctgtgtacccaatggacttcactgatggcatcattgggaaaagcaagagc
gtgggcaaatatgtcaccaccacactcttcctctacttcgcctgcctcctaccgaccatt
gcttttggatccctcaacgatgagaacacaaacggggccatcgatgtgcagaagaccata
gctggacagagcatcggaggcctcttgtatgcactgttctctgggcagcccctggtgata
ctgttgacaaccgcacccctggccatctacacccaggtgattcgagtcatctgtgatgac
tacaatctggacttcaacgccttctatgcatggacgggcctgtggaacagtttcttcctt
gcactttatgccttcctcaacctcagcctgcttatgaatctctttaagaggtctacagag
gaaatcattgctctgttcatttccatcacgtttgtgctggatgctgtcaagggcatggtc
aaaatcttcgggaagtactactatggtcaccactaccacacaaaaaggacttcctccttg
gtgagcctgttgggcattggcagaagccccaacagcagtctccacactgcactcaacgcc
agcctcttggccagccccgtagagatggccacaaccagcagccccggcagcacacactcg
ggccaggctacagcggtgctcagcctcctcatcatgttgggcacactctggctaggctac
accctctaccagttcaagaaaagcccctacctgcacccatgtgtgcgtgagaccctgtct
gactgtgccctgcccatcgccgtgctctccttctccctcatcggctcctatggcttccag
gaaattgagatgagcaagttccggtataaccccagcgagagcctttttgaggtggcacag
atccactctctgtccttcaaggccatcggcagtgccatgggtcttggtttcctgctctcc
ttgcttttcttcattgagcagaacctggtggcggccctggtcaatgcaccagagaacagg
ctggtgaagggcactgcctatcactgggatctcctgctacttgccatcatcaatacgggg
ctgtctctgtttgggctaccctggatccacgccgcctatccccactcccctctgcatgtg
cgggcactggccttagtggaggaacgcgtggagaatgggcacatttatgaaacgattgtg
gatgttaaggagactcggctgacggcgctgggtgccagtgtcctggtgggcctgtccttg
ctgctgctgccattccctctgcagtggatccccaagcctgtgctgtatgggctctttctg
tacattgcactgacctccctggacggcaaccagctcttctcgcgtgtggccctgctgctc
aaggagcagacatcatacccacccacacactacatccggagagtgccccaaaggaagatc
cactacttcacaggcctgcagatcctgcagctgctactgctctgtgccttcggcatgagc
tccctgccctacatgaagatggtctttcccctcatcatgattgccatgattccaatccgc
tacaatctgctaccccgaatcattgaggccaagtacttggatgtcatggatgctgagcat
aggccctga

DBGET integrated database retrieval system