KEGG   Mus musculus (mouse): 26939
Entry
26939             CDS       T01002                                 

Gene name
Polr3e, RP, RPC5, Sin
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide E
  KO
K14721  DNA-directed RNA polymerase III subunit RPC5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    26939 (Polr3e)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    26939 (Polr3e)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    26939 (Polr3e)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     26939 (Polr3e)
SSDB
Motif
Pfam: RPC5 RPC5_C zf-TFIIB
Other DBs
NCBI-GeneID: 26939
NCBI-ProteinID: NP_079574
MGI: 1349452
Ensembl: ENSMUSG00000030880
Vega: OTTMUSG00000059323
UniProt: Q9CZT4 Q3TWE8
Position
7; 7 F2
AA seq 710 aa
MANEEDDPVIQEIDVYLAKSLAEKLYLFQYPVRPASMTYDDIPHLSAKIKPKQQKVELEM
AIDTLNPNYCRSKGEQIALNVDGACADETSTYSSKLMDKQTFCSSQTTSNTARYAAALYR
QGELHLTPLHGILQLRPSFSYLDKADAKHREREAANEAGDSSQDEAEEDVKQITVRFSRP
ESEQARQRRVQSYEFLQKKHAEEPWVHLHYYGMRDSRSEHERQYLLCQGSSGVENTELVK
SPSEYLMMLMPPSPEEEKDKPVAPSNVLSMAQLRTLPLADQIKVLMKNVKVMPFANLMSL
LGPSVDSVAVLRGIQKVAMLVQGNWVVKSDILYPKDSSSPHSGMPAEVLCRGRDFVMWKF
TQSRWVVRKEVAAVTKLCAEDVKDFLEHMAVVRINKGWEFLLPYDLEFIKKHPDVVQRQH
MLWSGIQAKLEKVYNLVKETMPKKPDGQSAPVGLVSGEQRVQTAKTKAQQNHAFLERELQ
RRKEQMRAATVLPSVQIKEEPLSEEEADGAELEAEEEEPMDTAPSTCLSTKLANGLPAGR
AVGGDSLNGHPVPGCASNPVACELKAFVEATFQRQFVLTLSELKRLFNLHLAGLPPGHIL
FSGVSDRMLQDTVLAAGCKQILVPFPPQTAASPDEQKVFALWESGDMSDQHRQVLLEIFS
KNYRVRRNLIQSRLTQECGEELSKQEVDKVLKDCCVSCGGMWYLKGTVQS
NT seq 2133 nt   +upstreamnt  +downstreamnt
atggccaatgaagaagatgacccagtcatacaggagatcgatgtgtacttggctaaaagt
ctggcagagaagctgtatctctttcagtatcctgtgcgtcctgcttcaatgacctatgat
gacattccacatctctcagccaagatcaagcccaaacagcagaaggtagagcttgagatg
gccatcgacaccctgaatcccaactactgccgcagcaaaggggagcagatcgcactgaac
gtggacggtgcctgtgctgacgagactagcacatattcctcaaagctgatggacaagcag
accttctgctcctcccagaccaccagcaacacagctcgttatgccgctgcactctacagg
caaggtgagctccacctgacacctttacatggcatcctacagcttcggcccagcttctcc
taccttgataaggcagatgccaagcaccgagagagggaggcagccaatgaggcaggggat
tcttctcaggacgaggcagaagaagacgttaagcagatcacggtacggttctccaggcca
gagtccgagcaggctcgccagcgccgcgtgcagtcctatgagttcttgcagaagaagcat
gcagaagaaccctgggtccacctgcactactatggcatgagggacagccgctcagagcat
gagcgccagtacctgctgtgtcagggatccagcggggtagagaacacggagctcgtcaag
tcacccagtgaatacctcatgatgctcatgccgcccagcccagaggaggagaaggacaag
cctgtggctcccagcaatgtcttatctatggcccagctgcgtacattgcctctggctgat
cagattaaggtcctgatgaagaacgtgaaagtcatgcccttcgctaatctcatgagcctc
ctgggcccctctgtggactctgtggctgttctacgtggcatccagaaggtggcgatgtta
gtccaaggaaactgggtggtaaagagtgacatcctgtatcccaaggattcttccagccct
cacagtggcatgcctgctgaggtgctctgcaggggccgagactttgttatgtggaagttc
acacagagccgatgggtggtaagaaaggaggtggcagcagtgaccaaactctgcgctgag
gatgtgaaggactttctggagcacatggctgtagtgagaatcaacaaaggctgggagttc
ttactgccttacgacctggagtttatcaagaagcatccagatgtggtccagcggcagcac
atgctgtggtcgggcatccaggccaaattagaaaaagtctataatctcgtaaaagaaacc
atgccaaagaagccggatggacaatcagcgcctgttggtctggtctctggggaacagcgg
gtccaaacagccaaaaccaaggcccagcagaaccatgccttcttggagcgtgaactgcag
cgacggaaggagcagatgcgggcagccacagtcctgcccagcgtgcagatcaaggaggaa
cccctgagtgaggaggaagccgatggggctgagctggaggctgaggaagaggagcccatg
gacactgcacccagcacttgcctcagcaccaagttggccaatgggctgcctgctgggcgg
gcagtgggtggggacagcctaaatggacacccagttccaggctgtgccagcaacccggtt
gcctgtgaactgaaggcttttgtggaagccacctttcagagacagtttgtgctcacgctg
agcgaactcaagcgcctcttcaacctgcacctggcaggcctgcccccgggccatatactc
ttcagtggcgtctcagaccgaatgctacaggatacggtgctggccgctggctgcaagcag
atactggtgccttttcccccacagactgctgcttcccctgatgagcagaaggtatttgcc
ctctgggagtctggagacatgagtgaccagcatcggcaggttttgcttgaaatattttcc
aaaaattaccgagtacgtcggaacttgatccagtctcggctgactcaagaatgtggagaa
gagctaagcaaacaggaggtggataaagtgctaaaggactgttgtgtaagctgtggtggc
atgtggtaccttaaggggacagtacaatcctga

DBGET integrated database retrieval system