KEGG   Mus musculus (mouse): 269397
Entry
269397            CDS       T01002                                 

Gene name
Ss18l1, A230053O16Rik, CREST
Definition
(RefSeq) SS18, nBAF chromatin remodeling complex subunit like 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: SSXT
Other DBs
NCBI-GeneID: 269397
NCBI-ProteinID: NP_848865
MGI: 2444061
Ensembl: ENSMUSG00000039086
Vega: OTTMUSG00000016229
UniProt: Q8BW22
Position
2; 2 H4
AA seq 402 aa
MSVAFASARPRGKGEVTQQTIQKMLDENHHLIQCILDYQSKGKTAECTQYQQILHRNLVY
LATIADSNQNMQSLLPAPPTQNMNLGPGALSQSGSSQGLHPQGSLSDTVSTGLPPASLMQ
GQIGNGPNHVSMQQTAQSTLPTTSMSLSGSGHGTGPGYSHSGPTSQSVPMQGQGAISNYV
SRTNINMQSNPVSMMHQQAATSHYNSAQGGSQHYQGQAPIAMMGQGGQGGSMMGQRPMAP
YRPSQQGSSQQYLGQEEYYSEQYSHSQGSAEPMSQQYYPDGHGDYAYQQSSYTEQSYDRS
FEDPTQHYYEGGNSQYSQQQAGYQQGTAQQQTYSQQQYPNQQSYPGQQQGYGPAQGAPSQ
YSSYQQGQGQQYGSYRTSQTGPSAQQQRPYGYEQGQYGNYQQ
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgtccgtggccttcgcgtcggcgcggccgagaggcaaaggggaggtcactcagcagacc
atccagaagatgctggatgagaaccaccacctgatccagtgcatcctggactaccagagc
aagggcaagaccgccgagtgcacgcagtaccagcagatcctgcaccggaacctggtctac
ctagccaccatagcagactccaatcagaacatgcagtccctgcttcccgcgcctccaaca
cagaacatgaacctcgggcccggagcactgagtcagagtggttccagccagggcctgcac
ccccagggcagcctcagcgataccgtcagcacaggcctgccccccgcctccctcatgcag
ggccagatcggtaacggtccaaaccacgtgtccatgcagcagacggctcagagcacactg
cccacaacctccatgagcttgtcaggcagtggccatggtactggccctgggtacagccac
tcggggcctacctcgcagagtgtccccatgcaaggccaaggtgccatcagcaactatgtg
tctcggaccaacatcaacatgcagtctaacccagtctccatgatgcaccagcaggcagcc
acgtcccactacaactcagcacagggtggaagccagcattaccagggccaggcacccatt
gccatgatgggccagggtggccaaggaggcagcatgatggggcagcggcccatggcgccc
tacagaccctcccagcaaggctcttcccagcagtacctgggccaagaggagtactacagc
gaacagtacagccacagccagggctccgcagagcccatgagtcaacagtactacccggat
ggccacggtgactacgcctatcagcagtcgtcctacacagagcagagctacgaccgctcc
tttgaggatcccacacagcactactacgaggggggaaactcccagtacagtcagcagcag
gctgggtaccagcagggcacagcacagcagcagacctactcccagcaacagtatcccaac
cagcagagctacccggggcagcagcagggctacggtcctgcccagggagccccctcacag
tactcaagctaccagcaaggacaaggtcagcagtatggaagctacagaacatcgcagacg
ggaccttctgcccagcagcagcggccttacggctatgaacagggccagtatggaaattac
cagcaataa

DBGET integrated database retrieval system